Align ATPase (characterized, see rationale)
to candidate WP_011384952.1 AMB_RS12940 lipoprotein-releasing system ATP-binding protein LolD
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000009985.1:WP_011384952.1 Length = 226 Score = 146 bits (368), Expect = 4e-40 Identities = 84/208 (40%), Positives = 126/208 (60%), Gaps = 5/208 (2%) Query: 33 NQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSH--DR 90 + + L G +L ++ GE+V ++GPSG+GKST L LE GE+++ G+ ++ Sbjct: 20 DDLEVLKGANLEIRAGEIVALVGPSGAGKSTLLHIAGLLERPDGGEVFLAGNPAGALGEK 79 Query: 91 RDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQ 150 R +G V+Q +L P + ++N++L P + P A+A A +LL R+++AE+ Sbjct: 80 ERTQLRRLHLGFVYQYHHLLPEFSAIENVVL-PQMIAGVPQAKARERAMELLGRMKLAER 138 Query: 151 ADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLD-VMRDLASEGMT 209 A+ PGQLSGG+QQRVAI RALA PR+LL DEPT LDP V D ++R + G+ Sbjct: 139 AEHRPGQLSGGEQQRVAICRALANAPRVLLADEPTGNLDPHTADGVFDELIRLVKGSGVA 198 Query: 210 MLVATHEVGFAREVADRVVLMADGQIVE 237 L+ATH A + DRVV M++G +VE Sbjct: 199 ALIATHNPDLAARM-DRVVKMSEGLLVE 225 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 226 Length adjustment: 23 Effective length of query: 238 Effective length of database: 203 Effective search space: 48314 Effective search space used: 48314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory