Align ATPase (characterized, see rationale)
to candidate WP_011385145.1 AMB_RS13910 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000009985.1:WP_011385145.1 Length = 224 Score = 134 bits (336), Expect = 2e-36 Identities = 83/199 (41%), Positives = 116/199 (58%), Gaps = 4/199 (2%) Query: 41 VSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRD-IATIR-Q 98 + LTV RGE V + GPSGSGKS+ L L L+ G +W++G + D +A +R Sbjct: 26 IDLTVGRGEFVAVTGPSGSGKSSLLYLLGLLDVPTGGSVWLQGGNTAGLPPDAMAELRLA 85 Query: 99 EVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPGQL 158 +G VFQ L P T N+ + ++ +QA A +LL+ + +A+ KYP QL Sbjct: 86 SIGFVFQFHFLLPEFTCQSNVEIPIRRLGALSDSQARIRAAELLDSLELADHRRKYPDQL 145 Query: 159 SGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLA-SEGMTMLVATHEV 217 SGGQ+QRVAIARALA P ++L DEPT LD V ++ RDLA + T++V TH+ Sbjct: 146 SGGQRQRVAIARALANDPPLILADEPTGNLDTRTAHLVFELFRDLAHRQNRTVIVVTHDA 205 Query: 218 GFAREVADRVVLMADGQIV 236 A + ADR V + DG+IV Sbjct: 206 ELA-QTADRRVHLVDGRIV 223 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 224 Length adjustment: 23 Effective length of query: 238 Effective length of database: 201 Effective search space: 47838 Effective search space used: 47838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory