Align PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_011383520.1 AMB_RS05625 phosphate ABC transporter ATP-binding protein
Query= TCDB::Q88NY5 (256 letters) >NCBI__GCF_000009985.1:WP_011383520.1 Length = 260 Score = 136 bits (343), Expect = 4e-37 Identities = 88/233 (37%), Positives = 130/233 (55%), Gaps = 12/233 (5%) Query: 14 ISIKNVNKWYGDFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKCVNALEPFQK-----G 68 IS +++N YG+ Q L D + ++ G+V + GPSG GKST ++C+N + + G Sbjct: 13 ISARDLNVHYGEKQALFDVNLDIPVGQVTALIGPSGCGKSTFLRCINRMNDLVEIARVSG 72 Query: 69 DIVVDGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQR-KVLGRSEAEATK 127 + +DG I D ++ +LR+RVGMVFQ FP +I EN+ R L E + Sbjct: 73 SLFLDGIDIQDAAMDVVQLRARVGMVFQRPNPFPK-SIYENVAFGPRLHGLAAGADELDE 131 Query: 128 KGLALLDRVGLSAHAKKHPGQ----LSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEM 183 ++ LD+ GL K G+ LSGGQQQR+ IARA+A+ P V+L DEP SALDP Sbjct: 132 IVISSLDKAGLWGEVKDRMGETGTSLSGGQQQRLCIARAIAVAPEVILMDEPCSALDPIA 191 Query: 184 VSEVLDVMVQLAQEGMTMMCVTHEMGFARKVANRVIFMDKGSIIEDCTKEEFF 236 + V +++ +L + T++ VTH M A +V+ R F G +IE E F Sbjct: 192 TAAVEELIDEL-RGSYTIVIVTHSMQQAARVSQRTGFFHLGKLIEMGETESMF 243 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 260 Length adjustment: 24 Effective length of query: 232 Effective length of database: 236 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory