Align ATPase (characterized, see rationale)
to candidate WP_011385293.1 AMB_RS14680 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000009985.1:WP_011385293.1 Length = 225 Score = 130 bits (328), Expect = 2e-35 Identities = 86/226 (38%), Positives = 128/226 (56%), Gaps = 12/226 (5%) Query: 21 MIYAEGVEKWYG----NQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQR 76 MI+ V K + N+F AL G+ L+V+ G+V V GPSGSGK+T L + L Sbjct: 1 MIHLSDVRKAFNQGKSNEFWALKGIDLSVRAGKVTVFRGPSGSGKTTLLTLVGCLARPTS 60 Query: 77 GEIWIEGHRLSH-DRRDIATIRQEV-GMVFQQFNLFPHLTVLQNLMLA--PVQVRRWPVA 132 G + + +S R + IR+ G VFQQFNL ++ L+N+M+ P+ V R ++ Sbjct: 61 GRVRLRDRDISGLPERFLTDIRRSTFGFVFQQFNLLKGISALENVMIPAYPLGVDRKELS 120 Query: 133 QAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEM 192 + A L+E + I +A LSGG+ QRVAIARAL P +++ DEPT+ LD E Sbjct: 121 ER---AHALMESLGIGAKASSMAEWLSGGEAQRVAIARALINDPEVVIADEPTANLDSER 177 Query: 193 VREVLDVMRDLASEGMTMLVATHE-VGFAREVADRVVLMADGQIVE 237 R+ L ++ L + G T+L+ +H+ + EV D VV + DGQ+VE Sbjct: 178 SRQFLAIVETLKASGKTVLMTSHDPLVCDTEVVDHVVSLRDGQLVE 223 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 225 Length adjustment: 23 Effective length of query: 238 Effective length of database: 202 Effective search space: 48076 Effective search space used: 48076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory