Align ATPase (characterized, see rationale)
to candidate WP_043745616.1 AMB_RS21885 ABC transporter
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000009985.1:WP_043745616.1 Length = 229 Score = 128 bits (322), Expect = 9e-35 Identities = 81/205 (39%), Positives = 121/205 (59%), Gaps = 7/205 (3%) Query: 34 QFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSH-DRRD 92 + L G+ L V GE + ++GPSGSGKST L + LE G++ + G D Sbjct: 27 EVNVLDGIDLQVASGETLGVVGPSGSGKSTLLMVMAGLERPTSGKVAVAGQDFGPMDEDG 86 Query: 93 IATIRQE-VGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQA 151 +A R++ +G+VFQ F+L P +T L+N+ + P+++ A A++ L RV +A + Sbjct: 87 LARFRRDSIGIVFQSFHLIPTMTALENVAV-PLELAGH--ADPFGAAQEELGRVGLAHRL 143 Query: 152 DKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDL-ASEGMTM 210 YPGQLSGG+QQRVA+ARA +P++LL DEPT LD R V+D++ DL A G + Sbjct: 144 SHYPGQLSGGEQQRVALARAFVPRPKLLLADEPTGNLDGATGRAVMDLLFDLNARFGTAL 203 Query: 211 LVATHEVGFAREVADRVVLMADGQI 235 ++ TH+ A RVV + DG+I Sbjct: 204 VLVTHDDSLAAR-CTRVVRVEDGKI 227 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 229 Length adjustment: 24 Effective length of query: 237 Effective length of database: 205 Effective search space: 48585 Effective search space used: 48585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory