Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_011383520.1 AMB_RS05625 phosphate ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000009985.1:WP_011383520.1 Length = 260 Score = 135 bits (341), Expect = 7e-37 Identities = 84/250 (33%), Positives = 134/250 (53%), Gaps = 12/250 (4%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEE-----HQSG 77 I +N YG+ L D+NL + G+ + GPSG GKST +RCINR+ + SG Sbjct: 13 ISARDLNVHYGEKQALFDVNLDIPVGQVTALIGPSGCGKSTFLRCINRMNDLVEIARVSG 72 Query: 78 KIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAP-IWVRKVPKREAEE 136 + +DGI++ ++ ++R+ VGMVFQ N FP +I EN+ P + E +E Sbjct: 73 SLFLDGIDIQDAAMDVVQLRARVGMVFQRPNPFPK-SIYENVAFGPRLHGLAAGADELDE 131 Query: 137 TAMYYLEKVKIPEQAQKYPGQ----LSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEM 192 + L+K + + + G+ LSGGQQQR+ IAR++ + P+++L DEP SALDP + Sbjct: 132 IVISSLDKAGLWGEVKDRMGETGTSLSGGQQQRLCIARAIAVAPEVILMDEPCSALDP-I 190 Query: 193 IKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSER 252 ++ +I T++ VTH M A V+ R F G+++E F +PQ Sbjct: 191 ATAAVEELIDELRGSYTIVIVTHSMQQAARVSQRTGFFHLGKLIEMGETESMFTSPQHPL 250 Query: 253 TKQFLSQILG 262 T+ +++ G Sbjct: 251 TQGYITGRFG 260 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 260 Length adjustment: 25 Effective length of query: 238 Effective length of database: 235 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory