Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_011382978.1 AMB_RS02755 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000009985.1:WP_011382978.1 Length = 553 Score = 129 bits (323), Expect = 2e-34 Identities = 79/213 (37%), Positives = 124/213 (58%), Gaps = 7/213 (3%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 ++ELK V K YG VL++I+L +++GE + I+G SGSGK+T + M GL + +GEV++ Sbjct: 3 ILELKGVAKSYGASSVLRDIDLEIEDGEFIAILGFSGSGKTTLVSLMAGLIKPDAGEVLL 62 Query: 61 NNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLA-PMKLQKKSKKEAEETAFKY 119 ++ +VFQ ++L P +TV N+ LA + SK E + KY Sbjct: 63 RGKPVDGPGADR------GVVFQSYSLMPWLTVEGNIALAVDAVMPDASKAERKARVAKY 116 Query: 120 LKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMK 179 + +VGL A P+ LSGG +QRVA+AR+L +L DEP SALD T ++ D ++ Sbjct: 117 IGMVGLSHAAERRPSELSGGMRQRVAVARALAMSPDILLLDEPLSALDALTRAKLQDEIE 176 Query: 180 EISHQSNTTMVVVTHEMGFAKEVADRIIFMEDG 212 I Q T++++T+++ A +ADRII + G Sbjct: 177 AIWEQEKKTVILITNDVDEALLLADRIIPLNPG 209 Score = 105 bits (263), Expect = 1e-27 Identities = 76/244 (31%), Positives = 123/244 (50%), Gaps = 22/244 (9%) Query: 2 IELKNVNKYYGTHH----VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGE 57 +E V K Y T V+ +L + +GE + +IG SG GKST + GL +VS G Sbjct: 293 VEFSRVKKIYPTPKGPLTVVDGFDLKMHQGEFISLIGHSGCGKSTVLTMTAGLTDVSEGG 352 Query: 58 VVVNNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKK-SKKEAEETA 116 V+++ ++ A+VFQ +L+P +T LQN+ L ++ S E + Sbjct: 353 VILDGREVSEAGPDR------AVVFQAPSLFPWLTALQNVALGVDRVYPHASPAERLDIV 406 Query: 117 FKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLD 176 YL+ VGL D + + +S G +QRV IAR+ +L DEP LD T E+ + Sbjct: 407 SYYLERVGLGDSMDKKASDMSNGMRQRVGIARAFALSPKLLLLDEPFGMLDSLTRWELQE 466 Query: 177 VMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMED------GAIVEENIPSEFFSNPKTE 230 V+ E+ ++ T + VTH++ A +AD+++ M + G ++ +IP P+T Sbjct: 467 VLMEVWTRTRVTAICVTHDVDEAILLADKVVMMTNGPNARIGKVLNVDIP-----RPRTR 521 Query: 231 RARL 234 RA L Sbjct: 522 RALL 525 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 242 Length of database: 553 Length adjustment: 29 Effective length of query: 213 Effective length of database: 524 Effective search space: 111612 Effective search space used: 111612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory