Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_011383734.1 AMB_RS06730 nitrate ABC transporter ATP-binding protein
Query= TCDB::Q9WXN5 (330 letters) >NCBI__GCF_000009985.1:WP_011383734.1 Length = 452 Score = 89.0 bits (219), Expect = 2e-22 Identities = 66/211 (31%), Positives = 116/211 (54%), Gaps = 27/211 (12%) Query: 25 VDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFVELSS- 83 ++G+ F++ E E++ ++G+SG GK+TL L ++ G I + NG V+ Sbjct: 31 LEGVDFKLEEGEIVALLGKSGSGKSTL-----------LRIMAGLI--KANGGEVKYRGH 77 Query: 84 -MTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESHGIDEEELLDKARRRFE 142 MT K I+++ Q+ AL P + +E+ V E+ G+ + E ++A + Sbjct: 78 LMTGP-------AKGISMVFQSF--ALFPWLTVEENVELGLEAAGVAKAEREERANEAID 128 Query: 143 EVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVLLKVLMQ 202 +GL + YP ELSGGMRQR A A ++ P +L+ DEP SALDV+ + L + L++ Sbjct: 129 LIGLGG-YESAYPKELSGGMRQRVGFARALVMRPDVLLLDEPFSALDVLTSETLREDLLE 187 Query: 203 M--KRQGIVKSIIFITHDIATVRQIADRMII 231 + +R+ K I+ ++H+I +ADR+++ Sbjct: 188 LWDERKIPTKGILLVSHNIEEAVSMADRVLV 218 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 452 Length adjustment: 30 Effective length of query: 300 Effective length of database: 422 Effective search space: 126600 Effective search space used: 126600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory