GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TM0028 in Magnetospirillum magneticum AMB-1

Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_011386731.1 AMB_RS22185 ABC transporter ATP-binding protein

Query= TCDB::Q9WXN5
         (330 letters)



>lcl|NCBI__GCF_000009985.1:WP_011386731.1 AMB_RS22185 ABC
           transporter ATP-binding protein
          Length = 533

 Score =  131 bits (330), Expect = 3e-35
 Identities = 98/254 (38%), Positives = 141/254 (55%), Gaps = 16/254 (6%)

Query: 22  VKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKP-LTLVDGKIFLRVNGEFVE 80
           V+AV G+SF + + E + +VGESG GK+  +  I   +  P  T   G I  R++G   E
Sbjct: 20  VQAVKGVSFTLAKGETLALVGESGSGKSVTALSILQLLPYPRATHPRGSI--RLDG--AE 75

Query: 81  LSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESH-GIDEEELLDKARR 139
           L       + RK  G  I ++ Q  M +L P   +E  V  + E H G+    L D+   
Sbjct: 76  LVGAPEPAL-RKVRGGRIAMVFQEPMTSLNPLHSIEAQVGEVLELHLGLRGSTLRDRVVE 134

Query: 140 RFEEVGLDPLWIKRY---PFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVL 196
               VG+ P   KR    P ELSGG RQR +IA+A    P +LIADEPT+ALDV  Q  +
Sbjct: 135 LLSLVGI-PEPEKRLGALPHELSGGQRQRVMIAMALAGEPDILIADEPTTALDVTIQAQI 193

Query: 197 LKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYTQ 256
           L +L  ++ + +  +++FITHD+  VR++ADR+ +M AG+IVE  P+  + + P HPYTQ
Sbjct: 194 LALLKGLQAR-LGMALLFITHDLGIVRKMADRVCVMNAGEIVESGPLPQVFDAPAHPYTQ 252

Query: 257 GLFNSVLTPEPEVK 270
            L    L  EP+ K
Sbjct: 253 RL----LAAEPKGK 262



 Score =  130 bits (328), Expect = 6e-35
 Identities = 87/243 (35%), Positives = 131/243 (53%), Gaps = 22/243 (9%)

Query: 22  VKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFVE- 80
           VKAVDG+S ++     IGVVGESG GKTTL   +       L L+D    +   G  +E 
Sbjct: 297 VKAVDGISLDLKRGHTIGVVGESGSGKTTLGLAL-------LRLLDSDGEISFGGTRIES 349

Query: 81  LSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVR-----HLAESHGIDEEELLD 135
           +S+ T   ++R     ++ ++ Q    +L P + + + V      H    H  + + L+ 
Sbjct: 350 MSAGTLRPLRR-----QMQMVFQDPYGSLSPRMSVGQIVGEGLEVHEPAMHAAERDRLIA 404

Query: 136 KARRRFEEVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKV 195
            A    EEVGLDP    RYP E SGG RQR  IA A +L P  ++ DEPTSALDV  Q  
Sbjct: 405 AA---LEEVGLDPATRDRYPHEFSGGQRQRIAIARALVLKPKFIVLDEPTSALDVSVQAQ 461

Query: 196 LLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYT 255
           ++ +L  ++ +  + + +FI+HD+  VR +AD +++M  GK+VE    + L + P   YT
Sbjct: 462 IVDLLRDLQARHAL-AYLFISHDLRVVRALADDLLVMKDGKVVEAGRADELFKAPRTAYT 520

Query: 256 QGL 258
           + L
Sbjct: 521 RAL 523


Lambda     K      H
   0.321    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 444
Number of extensions: 15
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 330
Length of database: 533
Length adjustment: 32
Effective length of query: 298
Effective length of database: 501
Effective search space:   149298
Effective search space used:   149298
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory