Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_011386731.1 AMB_RS22185 ABC transporter ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >NCBI__GCF_000009985.1:WP_011386731.1 Length = 533 Score = 133 bits (334), Expect = 1e-35 Identities = 88/260 (33%), Positives = 144/260 (55%), Gaps = 11/260 (4%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFY--ALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVG 60 +M + + V F K GL++K + A+ +SL + +G + V+GESG+GKTTLG ++ Sbjct: 273 VMAARDLKVWFPLKAGLWRKTVGHVKAVDGISLDLKRGHTIGVVGESGSGKTTLGLALLR 332 Query: 61 LQKPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWE 120 L + GE+ + G I + R+ +Q++ QDPY +L +V +I+ + E Sbjct: 333 LLD-SDGEISFGGTRIESMSAGTLRPLRRQMQMVFQDPYGSLSPRMSVGQIVGEGLEVHE 391 Query: 121 KINKDELRKRLINL-LELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADE 179 R RLI LE V L PA +YPH+ SGGQ+QR++IAR+L + P+ IV DE Sbjct: 392 PAMHAAERDRLIAAALEEVGLDPATR--DRYPHEFSGGQRQRIAIARALVLKPKFIVLDE 449 Query: 180 PVTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVE 239 P + +D S++ I++ L +++ R L +FI+HD+ + R + +VM G++VE Sbjct: 450 PTSALDVSVQAQIVDLLRDLQARHALAYLFISHDLRVVRAL-----ADDLLVMKDGKVVE 504 Query: 240 RADLEEILKDPLHPYTNDLI 259 +E+ K P YT L+ Sbjct: 505 AGRADELFKAPRTAYTRALM 524 Score = 125 bits (313), Expect = 3e-33 Identities = 80/243 (32%), Positives = 128/243 (52%), Gaps = 11/243 (4%) Query: 27 ALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGL-----QKPTSGEVVYDGYNIWKNKR 81 A+K VS ++ +G+ L ++GESG+GK+ I+ L G + DG + Sbjct: 22 AVKGVSFTLAKGETLALVGESGSGKSVTALSILQLLPYPRATHPRGSIRLDGAELVGAPE 81 Query: 82 KIFKKYRKD-VQLIPQDPYSTLPFNKTVEEILVAPILRWEKINKDELRKRLINLLELVKL 140 +K R + ++ Q+P ++L ++E + + + LR R++ LL LV + Sbjct: 82 PALRKVRGGRIAMVFQEPMTSLNPLHSIEAQVGEVLELHLGLRGSTLRDRVVELLSLVGI 141 Query: 141 TPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLAEIK 200 E+ LG PH+LSGGQ+QR+ IA +L+ P I++ADEP T +D +++ IL L ++ Sbjct: 142 PEPEKRLGALPHELSGGQRQRVMIAMALAGEPDILIADEPTTALDVTIQAQILALLKGLQ 201 Query: 201 NRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDLIK 260 RL + ++FITHD+ I R VM AG IVE L ++ P HPYT L+ Sbjct: 202 ARLGMALLFITHDLGIVRKM-----ADRVCVMNAGEIVESGPLPQVFDAPAHPYTQRLLA 256 Query: 261 LTP 263 P Sbjct: 257 AEP 259 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 324 Length of database: 533 Length adjustment: 31 Effective length of query: 293 Effective length of database: 502 Effective search space: 147086 Effective search space used: 147086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory