Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_043743064.1 AMB_RS00985 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000009985.1:WP_043743064.1 Length = 328 Score = 173 bits (438), Expect = 6e-48 Identities = 106/252 (42%), Positives = 139/252 (55%), Gaps = 4/252 (1%) Query: 58 EGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVEL 117 + LK ++ G D D+A +RGI + NTP VLTE TAD +LI++ RR+ E Sbjct: 67 QAGPNLKLVANFGTGVDHIDLATARQRGITVTNTPGVLTEDTADMAMALIMSVPRRIAEG 126 Query: 118 AEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRS-AN 176 +++G W+ + G + GK LGI+G+GRIG AVARRA F M + Y NR + Sbjct: 127 ERLIRSGDWKGWSPTFMLGHRIWGKRLGIIGMGRIGQAVARRAK-AFGMSIHYHNRKRVH 185 Query: 177 PQAEEAYGARRVE-LAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGA 235 P E A E L ++LA D V + P TP T HL+ A L+ + K A ++N +RG Sbjct: 186 PDIETELEATYWESLDQMLARMDVVTVHCPHTPATFHLLSARRLELLPKHAYVVNTARGE 245 Query: 236 TVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMAR 295 VDE AL L G + GAGLDVFE EP + LL L NVV LPH+GSAT E R M Sbjct: 246 IVDENALTRMLIRGDLAGAGLDVFEHEPAVNPK-LLALDNVVLLPHLGSATIEGRVDMGE 304 Query: 296 NAAENLVAALDG 307 N+ DG Sbjct: 305 KVLVNIKTFADG 316 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 328 Length adjustment: 28 Effective length of query: 293 Effective length of database: 300 Effective search space: 87900 Effective search space used: 87900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory