Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_011385564.1 AMB_RS16165 phosphoglucosamine mutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000009985.1:WP_011385564.1 Length = 451 Score = 236 bits (602), Expect = 1e-66 Identities = 167/459 (36%), Positives = 240/459 (52%), Gaps = 21/459 (4%) Query: 3 KLFGTFGVRGIAN-EKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEAL 61 KLFGT G+RG AN + +T E AMK+GMA G R G + +VV+G+DTR+SG +L+ AL Sbjct: 4 KLFGTDGIRGTANTDPMTAEMAMKLGMAAGRHFTR-GDHRHVVVIGKDTRLSGYLLEPAL 62 Query: 62 ISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLK 121 +G +SVG DV+ +G PTPAV T+ AD G +I+ASHNP E NGIKL P+G L Sbjct: 63 TAGFISVGMDVVLLGPLPTPAVALLTRSMRADLGVMISASHNPYEDNGIKLFGPDGFKLS 122 Query: 122 KEREAIVEELFFKE-DFDRAKWYEIGEVRR-EDIIKPYIEAIKSKVDVEAIKKRKPFVVV 179 E E +E + R +G +R +D YIE K ++ +VV Sbjct: 123 DEDELTIEASMSNGLESCRVGSDHLGRAKRLDDAAGRYIEYAKYTFP-RGLRLDGLKIVV 181 Query: 180 DTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFG 239 D +NGA P +L ELG +VI V PDG+ N + + E V A GA G Sbjct: 182 DCANGAAYKVAPTVLWELGAEVIPVAVNPDGF--NINKNCGSLHTETMREQVVAHGAHLG 239 Query: 240 VAQDGDADRAVFIDENGRFIQGDKTFALVADAVLKE---KGGGLLVTTVATSNL-LDDIA 295 +A DGDADR V DE G I GD+ AL+ D + KGGG++ T + SNL L+ Sbjct: 240 IALDGDADRVVLCDELGHMIDGDQLMALIGDLWHRSGQLKGGGIVATVM--SNLGLERFL 297 Query: 296 KKHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAK 355 + G K +RT VGD V + + +GGE++G +I +H DG + +V+ + Sbjct: 298 DQRGLKTIRTAVGDRYVLEHMRRDGFNVGGEQSGHIILSDHSTTGDGLVAGLQVLAALVQ 357 Query: 356 SGKKFSELIDELPKYYQI-KTKRHVEGDRHAIVNKVAEMARERGYTVDTTDGAKIIFEDG 414 SGK SE++ Q+ K R +G VAE+ D + G Sbjct: 358 SGKPASEMLRLFTPLPQVLKNVRVAKG-------SVAEVLAAPAVEAAIRDAEAKLAGQG 410 Query: 415 WVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELLEKA 453 +L+R SGTEP+IR+ +E + + + ++ +E + +A Sbjct: 411 RLLIRKSGTEPLIRVMAEGEDEGLVEASVDAIVETIRRA 449 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 451 Length adjustment: 33 Effective length of query: 422 Effective length of database: 418 Effective search space: 176396 Effective search space used: 176396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory