Align citrate transporter (characterized)
to candidate WP_083763475.1 AMB_RS08370 MFS transporter
Query= CharProtDB::CH_014606 (431 letters) >NCBI__GCF_000009985.1:WP_083763475.1 Length = 445 Score = 227 bits (579), Expect = 5e-64 Identities = 137/413 (33%), Positives = 222/413 (53%), Gaps = 21/413 (5%) Query: 10 TFGAILRV---TSGNFLEQFDFFLFGFYATYIAKTFFPAESEFAALMLTFAVFGSGFLMR 66 T G IL V + GN +E +D++++ ++ Y +K FFP + L+ T A+F GF MR Sbjct: 24 TKGKILMVFKGSVGNLVEYYDWYVYSAFSLYFSKYFFPGDDPTVQLLNTSAIFALGFFMR 83 Query: 67 PIGAVVLGAYIDRIGRRKGLMITLAIMGCGTLLIALVPGYQTIGLLAPVLVLVGRLLQGF 126 P+G +LG + DR GR+ L++++++M G+L+IA++PGY +IG+ AP+ +++ RLLQG Sbjct: 84 PLGGWLLGTHADRKGRKAALLVSVSMMCAGSLIIAVMPGYNSIGVAAPIALILARLLQGL 143 Query: 127 SAGVELGGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYGL-----NVTLGHDE 181 S G E G + YLSEIAT +GFY+S+ Q V +++ L+ G+ V L E Sbjct: 144 SLGGEYGSAATYLSEIATKDRRGFYSSF----QYVTLIMGQLLALGVLMALQRVFLTTAE 199 Query: 182 ISEWGWRIPFFIGCMIIPLIFVLRRSLQETEAFLQRKHRPDTREIFTTIAKNWRIITAGT 241 + WGWRIPF IG + + LR S++ETE+F K + ++ R + Sbjct: 200 LEAWGWRIPFVIGGLCAIVAIYLRSSMEETESFEHHKGDRVGESRIRALMRHPREVLTVI 259 Query: 242 LLVAMTTTTFYFITVYTPTYGRTVLNLSARDSLVVTMLVGISNFIWL---PIGGAISDRI 298 L T FY T Y Y S D+ TM+ + F+++ P+ G ISD++ Sbjct: 260 GLTMGGTVAFYTFTTYMQKYLVNTAGFSKSDA---TMISAAATFVYMLMHPLVGHISDKV 316 Query: 299 GRRPVLMGITLLALVTTLPVMNWLTAAPD-FTRMTLVLLWFSFFFGMYNGAMVAALTEVM 357 GRR VL+ +++ + T+P++ L D T LVL + G Y+ E+ Sbjct: 317 GRRAVLIAFGVMSTLCTVPILTALGQTHDSVTAFFLVLSGLTIVSG-YSAINAVVKAELF 375 Query: 358 PVYVRTVGFSLAFSLATAIFGGLTPAISTALVQLTGDKSSPGWWLMCAALCGL 410 PV +R +G L F++ ++FGG I+ + G+++ W++ LCGL Sbjct: 376 PVQIRALGVGLPFAIGVSLFGGTAEYIALWFKSM-GNETWFYWYVTGCCLCGL 427 Lambda K H 0.328 0.141 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 445 Length adjustment: 32 Effective length of query: 399 Effective length of database: 413 Effective search space: 164787 Effective search space used: 164787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory