GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Magnetospirillum magneticum AMB-1

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate WP_011382988.1 AMB_RS02820 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>lcl|NCBI__GCF_000009985.1:WP_011382988.1 AMB_RS02820
           pyrroline-5-carboxylate reductase
          Length = 263

 Score =  155 bits (393), Expect = 6e-43
 Identities = 106/269 (39%), Positives = 141/269 (52%), Gaps = 14/269 (5%)

Query: 5   RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64
           +I  +G G M ++++ G   +GV    +   DP +          A+ VV S+A A+  A
Sbjct: 3   KILLVGCGKMGSAMLAGWLERGVAPGDVVVVDPSSPDLG------AVGVVTSDA-AIPSA 55

Query: 65  ---DVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPN 121
              DVV+ +VKPQ M  V    A       + +SIAAG   A     LG    +VR MPN
Sbjct: 56  FVPDVVIFAVKPQVMAEVVPPYARF--DRSVFLSIAAGKTIAFFRNHLGAKAVIVRAMPN 113

Query: 122 TPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFF 181
           TPA +R+G +   A   V A   E    LL AVG   W+DDE  +D VTAVSGSGPAY F
Sbjct: 114 TPAAVRRGITVCCAGEAVPAVARELCQSLLEAVGEVGWVDDEGLMDVVTAVSGSGPAYIF 173

Query: 182 LLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAI 241
           LL +AM  AG   GL    A RL   T  GA ++   S     +LR+ VTSP GTT AA+
Sbjct: 174 LLAEAMEAAGLAQGLPPALAERLARATVAGAGELLRLSAESAEQLRKNVTSPGGTTAAAL 233

Query: 242 KSFQA--NGFEALVEQALNAASQRSAELA 268
               A  +G  +L+ +A+ AA++R  ELA
Sbjct: 234 SVLMAESHGIPSLMTEAVAAATRRGRELA 262


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 198
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 263
Length adjustment: 25
Effective length of query: 248
Effective length of database: 238
Effective search space:    59024
Effective search space used:    59024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate WP_011382988.1 AMB_RS02820 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.5645.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    2.1e-75  239.7   2.3    2.4e-75  239.5   2.3    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011382988.1  AMB_RS02820 pyrroline-5-carboxyl


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011382988.1  AMB_RS02820 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  239.5   2.3   2.4e-75   2.4e-75       1     263 []       4     261 ..       4     261 .. 0.92

  Alignments for each domain:
  == domain 1  score: 239.5 bits;  conditional E-value: 2.4e-75
                                 TIGR00112   1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKP 69 
                                               i ++G+G+mg+a+l+g+l++g++ + +++v+++s++ l a     gv ++ +a   +   dvv++avKP
  lcl|NCBI__GCF_000009985.1:WP_011382988.1   4 ILLVGCGKMGSAMLAGWLERGVA-PGDVVVVDPSSPDLGAV----GVVTSDAAIPSAFVPDVVIFAVKP 67 
                                               679****************9887.89*****9887766654....4444444444455789******** PP

                                 TIGR00112  70 qdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevse 138
                                               q++ ev+  ++       ++++Si+AG ti+ ++++l+a++ +vR+mPNt+a+v++g+t+ +a+++v +
  lcl|NCBI__GCF_000009985.1:WP_011382988.1  68 QVMAEVVPPYAR---FDRSVFLSIAAGKTIAFFRNHLGAKAVIVRAMPNTPAAVRRGITVCCAGEAVPA 133
                                               ********9988...5679*********************************************99988 PP

                                 TIGR00112 139 eqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlk 206
                                                 +el ++ll+avG+v +v+ e l+d vta+sGSgPA++fll+ea+++ag+++GLp ++a++la++t++
  lcl|NCBI__GCF_000009985.1:WP_011382988.1 134 VARELCQSLLEAVGEVGWVDdEGLMDVVTAVSGSGPAYIFLLAEAMEAAGLAQGLPPALAERLARATVA 202
                                               8*******************9************************************************ PP

                                 TIGR00112 207 GaaklleesgehpalLkdkVtsPgGtTiaglavL..eekgvrsavieaveaavkrseeL 263
                                               Ga++ll  s e++++L+++VtsPgGtT+a+l+vL  e +g+ s + eav aa++r +eL
  lcl|NCBI__GCF_000009985.1:WP_011382988.1 203 GAGELLRLSAESAEQLRKNVTSPGGTTAAALSVLmaESHGIPSLMTEAVAAATRRGREL 261
                                               **********************************3334679**************9997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (263 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.01
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory