Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_011383782.1 AMB_RS06945 phosphate ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_000009985.1:WP_011383782.1 Length = 259 Score = 134 bits (336), Expect = 3e-36 Identities = 95/259 (36%), Positives = 136/259 (52%), Gaps = 22/259 (8%) Query: 26 KLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQ-----PDA 80 K+ G++ YGE + L + L+ G+V +LIG SG GKST LRCIN + Sbjct: 11 KISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCINRMNDMVDGAKVT 70 Query: 81 GVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPR-R 139 G +TLDG + R D +Q LR R+ MVFQ N + ++ +N+ PR Sbjct: 71 GSLTLDGSDVYDRS---------LDVVQ-LRARVGMVFQKPNPFPK-SIYDNVAYGPRIH 119 Query: 140 VLDVSAAEAEKRARMYLDKVGLPSRVADQYPAF---LSGGQQQRVAIARALAMEPEIILF 196 L AE ++ L+K GL + V + LSGGQQQR+ IARA+A+ PE+IL Sbjct: 120 GLARDQAELDEIVMNSLEKAGLLAEVESRLSESGTGLSGGQQQRLCIARAIAVAPEVILM 179 Query: 197 DEPTSALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VEEHGD 255 DEP SALDP +V ++I L + T+++VTH M A +VS + F H G+ +E G Sbjct: 180 DEPCSALDPIATAKVEELIDEL-RDNYTIVIVTHSMQQAARVSQRTAFFHLGKLIEVGGT 238 Query: 256 ARILDQPNSERLQQFLSNR 274 I P Q +++ R Sbjct: 239 EEIFTNPKEPLTQGYITGR 257 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 259 Length adjustment: 25 Effective length of query: 251 Effective length of database: 234 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory