GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Magnetospirillum magneticum AMB-1

Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_011382764.1 AMB_RS01610 ornithine carbamoyltransferase

Query= BRENDA::Q98BB6
         (303 letters)



>lcl|NCBI__GCF_000009985.1:WP_011382764.1 AMB_RS01610 ornithine
           carbamoyltransferase
          Length = 305

 Score =  341 bits (874), Expect = 1e-98
 Identities = 172/298 (57%), Positives = 210/298 (70%), Gaps = 4/298 (1%)

Query: 4   RHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERTRPLEGKVLAMIFDKPSTRTRVSFDVG 63
           RHF DL       LR +LD  +  K   +      PL GK+LAMIF+KPSTRTRVSF+VG
Sbjct: 11  RHFLDLDGFDTATLRHILDLGLAYK---QGKGPKAPLAGKMLAMIFEKPSTRTRVSFEVG 67

Query: 64  MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVPVI 123
           M+QLGG+ IML   + QLGR ETIADTA+VLSR+VDA+MIRT   ++L EL + A VPVI
Sbjct: 68  MKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDAVMIRTNLPEKLTELAKYADVPVI 127

Query: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183
           NGLTD +HPCQ+MAD+MTFEEHRG + GK +AW GDGNNV  S + A+  F   + +A P
Sbjct: 128 NGLTDQSHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLACP 187

Query: 184 EGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARGHNVFSPYQ 243
           +   P++  +DW++A G  +  T  P EAV  A  V+TD WVSMG +   R H +  PYQ
Sbjct: 188 DSLMPSRAAVDWARAKGASVVLTTHPAEAVAGAHLVLTDTWVSMGCQDSNR-HELLEPYQ 246

Query: 244 VNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCL 301
           VN  LMA A PDALFMHCLPAHRGEEVTD V+DG  SVV+DEAENR+H QK +L WCL
Sbjct: 247 VNEALMAKAAPDALFMHCLPAHRGEEVTDPVMDGIQSVVWDEAENRMHVQKGILTWCL 304


Lambda     K      H
   0.320    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 343
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 303
Length of database: 305
Length adjustment: 27
Effective length of query: 276
Effective length of database: 278
Effective search space:    76728
Effective search space used:    76728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate WP_011382764.1 AMB_RS01610 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.5939.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   1.3e-115  371.7   0.0   1.5e-115  371.5   0.0    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011382764.1  AMB_RS01610 ornithine carbamoylt


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011382764.1  AMB_RS01610 ornithine carbamoyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  371.5   0.0  1.5e-115  1.5e-115       1     303 [.      11     304 ..      11     305 .] 0.98

  Alignments for each domain:
  == domain 1  score: 371.5 bits;  conditional E-value: 1.5e-115
                                 TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 
                                               rh+l+l  ++++ l+++l+l+  +k+ k     ++ l gk la+iFek+stRtRvsfev++ +lG+ v+
  lcl|NCBI__GCF_000009985.1:WP_011382764.1  11 RHFLDLDGFDTATLRHILDLGLAYKQGKGP---KAPLAGKMLAMIFEKPSTRTRVSFEVGMKQLGGDVI 76 
                                               8*************************9988...689********************************* PP

                                 TIGR00658  70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138
                                               +l + ++qlgr+e+i+Dtarvlsr+vda+++R++  e+++elakya vPvingLtd++hPcq++aD++t
  lcl|NCBI__GCF_000009985.1:WP_011382764.1  77 MLAAGDTQLGRGETIADTARVLSRFVDAVMIRTNLPEKLTELAKYADVPVINGLTDQSHPCQVMADVMT 145
                                               ********************************************************************* PP

                                 TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207
                                                +e+ g+lk+  +++vGD+nnva s + aa  +G ++++a+P+ l p+ + v++a++    +g+++ lt
  lcl|NCBI__GCF_000009985.1:WP_011382764.1 146 FEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGCEIRLACPDSLMPSRAAVDWARA----KGASVVLT 210
                                               *****************************************************9965....9******* PP

                                 TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276
                                                 p++av++a+++ tD+wvsmG ++++  r +ll+pyqvne l++ a p++ f+hCLPa+rGeevtd v
  lcl|NCBI__GCF_000009985.1:WP_011382764.1 211 THPAEAVAGAHLVLTDTWVSMGCQDSN--RHELLEPYQVNEALMAKAAPDALFMHCLPAHRGEEVTDPV 277
                                               **********************99887..999************************************* PP

                                 TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303
                                               ++g +s+v+deaenR+h+qk++l+++l
  lcl|NCBI__GCF_000009985.1:WP_011382764.1 278 MDGIQSVVWDEAENRMHVQKGILTWCL 304
                                               ***********************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (305 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.33
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory