Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_011384976.1 AMB_RS13060 acetyl-CoA C-acyltransferase
Query= SwissProt::Q0AVM3 (396 letters) >NCBI__GCF_000009985.1:WP_011384976.1 Length = 398 Score = 304 bits (779), Expect = 3e-87 Identities = 173/398 (43%), Positives = 240/398 (60%), Gaps = 27/398 (6%) Query: 12 RTPVGTFGGTLKDVGSAQLGAIVMGEAIKRAGIKAEQIDEVIFGCVLQAGL-GQNVARQC 70 R+P+G GG L V S L A V+ + R+ K E +++VI GC QAG +NVAR Sbjct: 11 RSPIGRHGGGLAPVRSDDLAAEVIRALVARSSFKPEDVEDVILGCTNQAGEDSRNVARHA 70 Query: 71 MINAGIPKEVTAFTINKVCGSGLRAVSLAAQVIKAGDADIIMAGGTENMDKAPFILP--N 128 + AG+P EV T+N++C SGL AV AA+ + G+ D+ +AGG E+M +APF+L + Sbjct: 71 ALLAGLPVEVAGQTVNRLCASGLAAVLDAARSVTCGEGDLYLAGGVESMTRAPFVLAKGD 130 Query: 129 ARW-----------GYRMSMPKGDLIDEMVWGGLTDVFNGYHMGITAENINDMYGITREE 177 + W G R + PK + F G+ M TA+NI G++RE Sbjct: 131 SAWSRDARIFDTTIGARFANPK-----------VVKSFGGHSMPETADNIAHDLGLSREA 179 Query: 178 QDAFGFRSQTLAAQAIESGRFKDEIVPVVIKGKKGDIVFDTDEHPRKSTP-EAMAKLAPA 236 DAF SQ A+A G ++ EI P+ I G+KGD + DEHPR T A+ KL P Sbjct: 180 SDAFAAASQAKYAKAKAEGFYEGEIHPITIAGRKGDTIVAEDEHPRPQTDLAALTKLKPL 239 Query: 237 FKKGGSVTAGNASGINDAAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLGPIP 296 F+ GG VTAGNASGIND AAA+ + S+ ++ GI P+A++V+ A+ GV P VMGLGP+P Sbjct: 240 FE-GGVVTAGNASGINDGAAALFIGSRAAGEKAGIAPIARIVAGAAAGVPPRVMGLGPVP 298 Query: 297 ASRKALEKAGLTIDDIDLIEANEAFAAQSIAVARDLGWADKMEKVNVNGGAIAIGHPIGS 356 A KAL +A L++ D+DLIE NEAFA Q + LG A ++N NGGAIAIGHP+G Sbjct: 299 AITKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLGC 358 Query: 357 SGARILVTLLYEMQKRGSKKGLATLCIGGGMGTALIVE 394 SGAR+ +T ++Q+ G + + +LCIG G G A ++E Sbjct: 359 SGARLALTAARQLQRTGGRHAVVSLCIGVGHGLAAVIE 396 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 398 Length adjustment: 31 Effective length of query: 365 Effective length of database: 367 Effective search space: 133955 Effective search space used: 133955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory