GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Magnetospirillum magneticum AMB-1

Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_011384978.1 AMB_RS13070 enoyl-CoA hydratase

Query= reanno::psRCH2:GFF2389
         (257 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384978.1 AMB_RS13070 enoyl-CoA
           hydratase
          Length = 256

 Score =  209 bits (531), Expect = 6e-59
 Identities = 116/254 (45%), Positives = 160/254 (62%)

Query: 4   ETLLVDIQERVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAA 63
           E LL    + V L+ +NRP A NALNG++   L + +  L ADP +  IV+TG+ +AFAA
Sbjct: 3   EVLLEKPFDSVVLLRINRPDAKNALNGEVRRLLAEHMTTLGADPSVRAIVMTGNQEAFAA 62

Query: 64  GADIKEMAELTYPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCELALLCDMIFAAD 123
           GADIK+MAE+   ++   +       IA   KP+IAAV GYA GGGCEL +  D+I A +
Sbjct: 63  GADIKDMAEVGAIELMQRNNHLLWRAIANCPKPVIAAVNGYAWGGGCELVMHADIIVAGE 122

Query: 124 NARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFPAE 183
           NA F QPEV +G++PG GGTQRLTRAVGK KAM M +TG+ +   EA + GL + V P  
Sbjct: 123 NASFSQPEVKVGIMPGAGGTQRLTRAVGKFKAMLMVMTGQAISGVEAGQMGLASVVVPDA 182

Query: 184 SLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQKEGM 243
            ++++ L+ A+ I+     A   IKE +    + +L   +  ER+ F  +FA+ADQKEGM
Sbjct: 183 EVVDKALEIAKTISRMPPVAIAQIKEVLLAGQDASLDTALMLERKAFQLLFASADQKEGM 242

Query: 244 AAFSEKRKPEFTNR 257
            AF EKRKP +  +
Sbjct: 243 KAFIEKRKPTYQGK 256


Lambda     K      H
   0.321    0.135    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 161
Number of extensions: 4
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 257
Length of database: 256
Length adjustment: 24
Effective length of query: 233
Effective length of database: 232
Effective search space:    54056
Effective search space used:    54056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory