Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_011383730.1 AMB_RS06710 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::C6KEM4 (506 letters) >NCBI__GCF_000009985.1:WP_011383730.1 Length = 485 Score = 318 bits (815), Expect = 3e-91 Identities = 195/475 (41%), Positives = 269/475 (56%), Gaps = 12/475 (2%) Query: 13 FIGGAWREPCLGRRLPVVNPATEATIGDIPAGTAEDVEIAVAAARDAFSRDGGRQWSRAP 72 +I G+W G RL V NPA + I +PA A + A+ AA A+ W Sbjct: 15 YINGSWVAAQSGERLAVTNPADGSLIIRVPAMGAAETRQAIEAADRAWG-----PWKAKT 69 Query: 73 GAVRANFLRAIAAKIKDRKSELALLETLDSGKPLDEASGDMDDVAACFEYYADLAEALDG 132 R+ LR I +++LA L T + GKPL EA G++ A+ E++A+ A+ + G Sbjct: 70 AKERSAVLRRWFELIMAAQNDLAKLMTAEQGKPLAEAKGEVAYGASFVEWFAEEAKRVYG 129 Query: 133 KQRSPISLPMENFKSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCTTILKPSELA 192 I M + V+KEPIGVV ITPWN+PL M T K APALAAGC ++KP+E Sbjct: 130 ---DTIPEHMPGRRIVVVKEPIGVVAAITPWNFPLAMITRKCAPALAAGCPVVVKPAEDT 186 Query: 193 SVSCLELGAICMEIGLPPGVLNIITGLGPEA-GAPLSSHSHVDKVAFTGSTETGKRIMTS 251 +S L L + G PPGV N+IT P+A G L+++ V K++FTGSTE GK +M Sbjct: 187 PLSALALAELAERAGFPPGVFNVITAGDPKAVGFELTANPKVRKLSFTGSTEVGKLLMAQ 246 Query: 252 AAQMVKPVSLELGGKSPLIVFDDIGDIDKAVEWTMFGIFANAGQVCSATSRLLLHEKIAK 311 A VK +SLELGG +P +VFDD D+D AV M + N GQ C +RLL+ + I Sbjct: 247 CAATVKKLSLELGGNAPFMVFDD-ADLDAAVAGAMASKYRNTGQTCVCANRLLVQDGIYD 305 Query: 312 KFLDRLVAWAKNIKVSDPLEEGCRLGSVISEGQYEKIKKFISTARSEGATILYGGGRPQH 371 F RL +KV LE + G +I+E K+++ I+ A ++GA ++ GG R H Sbjct: 306 AFTARLAEAVAALKVGPGLEGDFQQGPLINEEAVRKVERHIADAVAKGARVVMGGKR--H 363 Query: 372 LRRGFFLEPTIITDVSTSMQIWQEEVFGPVICVKEFRTDSEAVELANDTHYGLAGAVISN 431 R G F EPTI+ DV+ M +EE FGPV + F+T+ EAV +ANDT +GLA S Sbjct: 364 ARGGTFFEPTILADVTPDMAPAREETFGPVAPLFRFKTEEEAVRMANDTEFGLAAYFYSR 423 Query: 432 DQERCERISKALHSGIIWINCSQPCFVQAPWGGNKRSGFGRELGEWGLDNYLTVK 486 D R R+S+AL GI+ IN AP+GG K SG GRE ++G++++L VK Sbjct: 424 DVGRVWRVSRALEYGIVGINEGLISTEVAPFGGVKESGLGREGSKYGIEDFLEVK 478 Lambda K H 0.318 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 643 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 485 Length adjustment: 34 Effective length of query: 472 Effective length of database: 451 Effective search space: 212872 Effective search space used: 212872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory