GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocD in Magnetospirillum magneticum AMB-1

Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate WP_083763404.1 AMB_RS01605 aspartate aminotransferase family protein

Query= curated2:Q4A0N2
         (394 letters)



>lcl|NCBI__GCF_000009985.1:WP_083763404.1 AMB_RS01605 aspartate
           aminotransferase family protein
          Length = 384

 Score =  235 bits (599), Expect = 2e-66
 Identities = 127/382 (33%), Positives = 210/382 (54%), Gaps = 6/382 (1%)

Query: 16  YSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQRITMVSRA 75
           Y+   LA  +G GA ++  +   Y+D  +G +V   GHCHP+++KAL  Q+ ++   S  
Sbjct: 4   YARADLAFERGEGAYLFTADGRRYLDFAAGVAVNALGHCHPRLVKALTAQAAKVWHTSNL 63

Query: 76  LYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESSSEIIAMN 135
                      K+ + +  + V   N+G EA+E +IKMAR+      N       II   
Sbjct: 64  YRVAGQESVAAKLVERSFADTVFFCNSGAEALECSIKMARRHHFAAGN--PQRYRIICAE 121

Query: 136 GNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTAIILEPIQGE 195
           G FHGRTL +++   Q  + +GF P ++   +  +G++  L+  I  +T AI++EP+QGE
Sbjct: 122 GAFHGRTLATVAAGGQKKHLEGFAPAVDGFDHVPYGNLNALRASITEETAAILVEPVQGE 181

Query: 196 GGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENTEPDIYLLGKSLG 255
           GG+      +++ +R   +E+ +LLI DE+Q G+GRTG +FA E     PDI  + K LG
Sbjct: 182 GGIVPGDPDYLRRLRATADEFGLLLIFDEVQTGMGRTGTLFAHEQAGIAPDIMGVAKGLG 241

Query: 256 GGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQNALDLGDR 315
           GG +P+ A LA     S + PGTHGSTFGGNPLA AV+   LD++ E   +++   +   
Sbjct: 242 GG-FPVGACLATTKAASGMVPGTHGSTFGGNPLAMAVAGEVLDIMAEPGFLEHVQAMAAL 300

Query: 316 LLKHLQQIESE---LIVEVRGRGLFIGIELNVAAQDYCEQMINKGVLCKETQGNIIRIAP 372
           L   ++   +    ++ EVRG GL +GI+  +   +   ++   G+L      NI+R+ P
Sbjct: 301 LRSKVEDTAARFPGVVEEVRGLGLMLGIKPRMPNTEMVARLAEGGLLTVGAGDNIVRLLP 360

Query: 373 PLVIDKDEIDEVIRVITEVLEK 394
           PL+I+  ++DE + ++    ++
Sbjct: 361 PLIINDAQVDEAVGILARAFDE 382


Lambda     K      H
   0.317    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 329
Number of extensions: 13
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 394
Length of database: 384
Length adjustment: 30
Effective length of query: 364
Effective length of database: 354
Effective search space:   128856
Effective search space used:   128856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory