GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupC in Magnetospirillum magneticum AMB-1

Align Concentrative nucleoside transporter, CNT, of 418 aas and 12 TMSs. A repeat-swapped model of VcCNT predicts that nucleoside transport occurs via a mechanism involving an elevator-like substrate binding domain movement across the membrane (characterized)
to candidate WP_011386447.1 AMB_RS20720 nucleoside:proton symporter

Query= TCDB::Q9KPL5
         (418 letters)



>lcl|NCBI__GCF_000009985.1:WP_011386447.1 AMB_RS20720
           nucleoside:proton symporter
          Length = 413

 Score =  253 bits (646), Expect = 7e-72
 Identities = 150/417 (35%), Positives = 239/417 (57%), Gaps = 16/417 (3%)

Query: 7   LIGMAVLLGIAVLLSSNRKAINLRTVGGAFAIQFSLGAFILYVPWGQELLRGFSDAVSNV 66
           LIG+  L+G+A LLS +R+A++ R V    A+Q  L   +L VP  + L  G   AV+ +
Sbjct: 6   LIGIIALIGVAFLLSEDRRAVSWRVVVAGLAVQGLLALLLLKVPAAKLLFLGLDRAVAAL 65

Query: 67  INYGNDGTSFLFG--GLVSGKMFEVFGGGGFIFAFRVLPTLIFFSALISVLYYLGVMQWV 124
                 GTSF+FG  G             GFI AF+ LP ++  SAL ++LY+  ++  V
Sbjct: 66  QTATRAGTSFVFGYVGGAPAPWTAANPASGFILAFQALPLVLLMSALSALLYHWRILPVV 125

Query: 125 IRILGGGLQKALGTSRAESMSAAANIFVGQTEAPLVVRPFVPKMTQSELFAVMCGGLASI 184
           +R     L+K++G   A  +SA+A  F+G  EAPL++RP+V K+++ ELF VM  G+++I
Sbjct: 126 VRAASRLLEKSMGVGGAVGVSASATAFLGMIEAPLLIRPYVGKLSRGELFLVMTAGMSTI 185

Query: 185 AGGVLAGYASM--GV---KIEYLVAASFMAAPGGLLFAKLMMPETEKPQDNEDITLDGGD 239
           AG V+  YA+   G+    I +L+ AS ++ P GL+  K+M+P+       +   L  G 
Sbjct: 186 AGTVMVLYATFLDGIIPDAIGHLLTASLISVPAGLMIGKIMVPDCALTGAGK---LGDGH 242

Query: 240 DKPANVIDAAAGGASAGLQLALNVGAMLIAFIGLIALINGMLGGIGGWFGMPELKLEMLL 299
           D  A  +DA   G   G++L + + AML+  + L++L N  L  +    G P L L+ +L
Sbjct: 243 DY-AGSMDAVVKGTMDGVRLLVGIVAMLVVLVALVSLANAGLALLPEVAGAP-LTLQRVL 300

Query: 300 GWLFAPLAFLIGVPWNEATVAGEFIGLKTVANEFVAYSQFAPYLTEAAPVVLSEKTKAII 359
           GW  AP+ + +G+P  E   AG  +G KTV NE +AY      L    P  LS +++ I+
Sbjct: 301 GWAMAPVVWAMGIPAGEMVTAGALMGTKTVLNELLAYLD----LAHLPPEALSARSRLIM 356

Query: 360 SFALCGFANLSSIAILLGGLGSLAPKRRGDIARMGVKAVIAGTLSNLMAATIAGFFL 416
           ++ LCGFANL S+ IL+ GL  +AP+RR +I  +G +++I+GT+++ +  ++ G  L
Sbjct: 357 TYGLCGFANLGSLGILIAGLSVMAPERRAEIVALGGRSIISGTMASCLTGSMVGLLL 413


Lambda     K      H
   0.325    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 485
Number of extensions: 28
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 413
Length adjustment: 31
Effective length of query: 387
Effective length of database: 382
Effective search space:   147834
Effective search space used:   147834
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory