Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_011382581.1 AMB_RS00675 KR domain-containing protein
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000009985.1:WP_011382581.1 Length = 238 Score = 103 bits (258), Expect = 3e-27 Identities = 75/247 (30%), Positives = 120/247 (48%), Gaps = 19/247 (7%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGVADVSDCAQ 71 G L++G GIGAAIA L GA V + P A + + + D +D A Sbjct: 6 GKLALVTGGTRGIGAAIAARLLADGAKVMVTGTRPGGEGPAGSGYLAV-----DFADAAA 60 Query: 72 VDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPL 131 + A G+D+L+NNAGI ++DPA++ R N+ + F R VP Sbjct: 61 TTAFAEQAAGL--GVDILVNNAGI-NKVSPFAEIDPADFARIQQVNVTAPFLLARAVVPG 117 Query: 132 LKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGV 191 + + A I+ ++S+ GR+ A R Y+ASK+A+ G+ +LA E+ + N + PG Sbjct: 118 M-QAKAWGRIVTVSSIWGRISRAGRGAYSASKFAVDGLTAALAAEVAQFGILANCVAPGF 176 Query: 192 VEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNISG 251 ++ E +V +G D +K E ++ RR+ ++AA +LA P ISG Sbjct: 177 IDTELTRQV---------LGEDGIK-ELTAQVPARRLGRPEEIAAFVAWLAGPENSYISG 226 Query: 252 QAISVDG 258 Q + +DG Sbjct: 227 QNLVIDG 233 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 238 Length adjustment: 24 Effective length of query: 239 Effective length of database: 214 Effective search space: 51146 Effective search space used: 51146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory