Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_011384971.1 AMB_RS13035 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000009985.1:WP_011384971.1 Length = 248 Score = 90.1 bits (222), Expect = 4e-23 Identities = 76/249 (30%), Positives = 123/249 (49%), Gaps = 17/249 (6%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRAR---TAHPQLHAGVA-DVSDCAQ 71 LI+G A+GIG ++ ++GA+V I D++ A ++A TA V DV+D A Sbjct: 9 LITGGASGIGYCTVKSMAELGADVLIADINVEAGEKAAAELTAKGFKAEFVRLDVTDKAN 68 Query: 72 VDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPL 131 + R+ + + G LD+L N AG G D D A + + NL +R PL Sbjct: 69 IARVKEHVVATRGRLDILCNVAGW-GHIQPFVDNDDAFIAKVMSLNLTGPIELIRAFFPL 127 Query: 132 LKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGV 191 + E I+ +AS AGR+G + Y+A+K ++ K+LA E N+ VNAI PG Sbjct: 128 MIEKKTGK-IVNVASDAGRVGSLGESVYSAAKGGLIAFSKALAREGARFNINVNAICPGP 186 Query: 192 VEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNISG 251 + + ++E ++ +L+ I +RR +VA +F+AS I+G Sbjct: 187 TDTPLL------KSEP-----EKFLEAFLKVIPMRRFGQPQEVADSIVFMASNRADYITG 235 Query: 252 QAISVDGNV 260 Q +SV+G + Sbjct: 236 QVLSVNGGI 244 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory