GapMind for catabolism of small carbon sources

 

Alignments for a candidate for drdehyd-alpha in Magnetospirillum magneticum AMB-1

Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate WP_043743639.1 AMB_RS06625 (2Fe-2S)-binding protein

Query= metacyc::MONOMER-20832
         (151 letters)



>NCBI__GCF_000009985.1:WP_043743639.1
          Length = 169

 Score =  124 bits (311), Expect = 7e-34
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 1/130 (0%)

Query: 14  ADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTPVAGVVGREITTIE 73
           AD D PL++ +R++LGLTGT  GCG  +CGAC+VL+DG   RSC T +    G+ +TTIE
Sbjct: 31  ADGDMPLVYWLREELGLTGTHLGCGKGECGACTVLIDGQPARSCRTTLGEAAGKVVTTIE 90

Query: 74  AIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKAQIDAAMI-NLCRC 132
            + T E    V A +VE Q AQCG+C  G V+   ALL  T  P  A++  A+  +LCRC
Sbjct: 91  GLGTPEAPHPVQAAFVEEQAAQCGFCTPGMVVEGAALLARTAQPDLAEVKEALDGHLCRC 150

Query: 133 GTYNAIHAAV 142
           G++  +  AV
Sbjct: 151 GSHQRVLKAV 160


Lambda     K      H
   0.320    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 105
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 151
Length of database: 169
Length adjustment: 17
Effective length of query: 134
Effective length of database: 152
Effective search space:    20368
Effective search space used:    20368
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory