Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_011384506.1 AMB_RS10625 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_000009985.1:WP_011384506.1 Length = 245 Score = 131 bits (329), Expect = 1e-35 Identities = 87/250 (34%), Positives = 131/250 (52%), Gaps = 22/250 (8%) Query: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIR---IDGLA---GKPVEARKLDVRD 58 L GKTAL+T A GIG A A+ GA V R +D LA G+ V ++ D Sbjct: 4 LTGKTALVTGASGGIGGAIAKALHARGATVGLHGTRREALDALAAELGERVHVLPANLSD 63 Query: 59 DAAIKALA----AEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFL 114 AA++ LA A +G+VD+L N AG G +L +EDW D+N+ A +R+ RA + Sbjct: 64 AAAVEQLAKDAEAAMGSVDILVNNAGLTKDGLVLRMKDEDWQTVLDVNLTAAFRLSRAAV 123 Query: 115 PAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICP 174 + + G IIN++S V G P + Y+ASKA +IG++K++A + +R + N + P Sbjct: 124 KGQMKRRWGRIINITSIV-GVTGNPGQVNYAASKAGMIGMSKALAQEVASRNITVNCVAP 182 Query: 175 GTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFT 234 G V+S + D + A P GR+G +EIAA +YL S E+++ Sbjct: 183 GFVSSAMTD-----------VLSDEQKTKLNAGIPAGRMGTADEIAAAVVYLASAEAAYV 231 Query: 235 TGHAHVIDGG 244 TG ++GG Sbjct: 232 TGQTLHVNGG 241 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 245 Length adjustment: 24 Effective length of query: 223 Effective length of database: 221 Effective search space: 49283 Effective search space used: 49283 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory