Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_011383159.1 AMB_RS03675 UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000009985.1:WP_011383159.1 Length = 360 Score = 190 bits (482), Expect = 5e-53 Identities = 119/279 (42%), Positives = 168/279 (60%), Gaps = 20/279 (7%) Query: 5 KTLMITGGTGSFGN----AVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNSK--- 57 K++++TGGTGSFG VL R+ +I IFSRDE KQ +M + ++ Sbjct: 34 KSILVTGGTGSFGKKFVKTVLERYNPHRLI-------IFSRDELKQFEMAQTFDPAQHRC 86 Query: 58 LKFYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAIN 117 L++++GDVR+ + + AM VD V HAAALKQVP E+ P E + TN+LGAENV+ AA+ Sbjct: 87 LRYFLGDVRDAERLRMAMREVDVVVHAAALKQVPAAEYNPFEFVRTNILGAENVVQAALA 146 Query: 118 NKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGS 177 NKV VI LSTDKA+ PIN G +K +K+ +A + T V RYGNV+ SRGS Sbjct: 147 NKVGHVIALSTDKAMSPINLYGATKLASDKIFVAANNLSGSVGTKFAVVRYGNVVGSRGS 206 Query: 178 VIPLFIHQIKQG-KELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIE 236 V+P F I+ G EL IT+ MTRF ++L VD VL + + G+ ++ K P+ + Sbjct: 207 VVPFFHKLIQSGAAELPITDARMTRFWITLEQGVDFVLSCLDKMQGGETYIPKIPSMRMT 266 Query: 237 VLAKALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAK 275 LA+A+ G + I IG R GEK +E ++ +ED A+ Sbjct: 267 DLAEAMAP--GKPHKI--IGIRPGEKIHEVMI-TEDYAR 300 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 360 Length adjustment: 29 Effective length of query: 312 Effective length of database: 331 Effective search space: 103272 Effective search space used: 103272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory