Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_043743408.1 AMB_RS04300 beta-ketoacyl-ACP reductase
Query= reanno::acidovorax_3H11:Ac3H11_614 (280 letters) >NCBI__GCF_000009985.1:WP_043743408.1 Length = 240 Score = 101 bits (251), Expect = 2e-26 Identities = 78/245 (31%), Positives = 118/245 (48%), Gaps = 12/245 (4%) Query: 36 GRAVFVTGGGSGIGAAIVAAFAEQGARVAFVDVAREASEALAQHIADAGLPRPWWRVCDV 95 GR VTGG GIG I + G +V + EA A+ A+ G+P W DV Sbjct: 2 GRLAIVTGGTRGIGREISVTLKKAGYKVVANYGGND--EAAAKFTAETGIPSMKW---DV 56 Query: 96 RDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINERPAFFAIQ 155 A +A +A AE G ++VNN TL ++ + ++E + N F + Sbjct: 57 GSYPACEAAIAKIVAEHGP-VEIIVNNAGITRDATLHRMSYQMWEEVIHTNLTSCFNMAR 115 Query: 156 AVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQDRIRINTV 215 + MR G G ++N+GS Q G YA AKS ++G T+ LA+ I +N + Sbjct: 116 LAIDSMRERGFGRIVNIGSINGQAGQYGQVNYAAAKSGIHGFTKALAQEGAAKNITVNAI 175 Query: 216 SPGWVMTERQIKLWLDAEGEKELARNQCLP-DKL-RPHDIARMVLFLASDDAAMCTAQEF 273 +PG+V T+ ++ A EK +A+ +P +L R DIAR V+FL +D+A T Sbjct: 176 APGYVDTD-MVRAVPPAVLEKIIAK---IPVGRLGRAEDIARCVMFLIADEADFITGSTL 231 Query: 274 KVDAG 278 V+ G Sbjct: 232 SVNGG 236 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 240 Length adjustment: 24 Effective length of query: 256 Effective length of database: 216 Effective search space: 55296 Effective search space used: 55296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory