Align Large component of TRAP-type D-gluconate transporter (characterized)
to candidate WP_011383335.1 AMB_RS04550 C4-dicarboxylate ABC transporter permease
Query= reanno::azobra:AZOBR_RS15920 (426 letters) >NCBI__GCF_000009985.1:WP_011383335.1 Length = 427 Score = 289 bits (739), Expect = 1e-82 Identities = 145/417 (34%), Positives = 251/417 (60%), Gaps = 2/417 (0%) Query: 1 MALAVFLSSLFGLMLLGMPIAFALMLTGVALMVHLDFFDAQLVAQNMLSGADNYPLMAVP 60 M AV L LML GMPI+ +L LT ++ + + VA + +G + + +MA+P Sbjct: 1 MNSAVIFGLLIVLMLTGMPISISLGLTVLSFLFLFTQVPIESVALKLFTGIEKFEIMAIP 60 Query: 61 FFILAGELMNAGGISQRIINLAVSLVGHIRGGLGYVTIGASVMLASLSGSAIADTAALAT 120 FFILAG + GG+++R+IN A ++VGH GGLG + A + A++SGS+ A A+ + Sbjct: 61 FFILAGNFLTHGGVARRMINFATAMVGHWYGGLGLAGVMACALFAAVSGSSPATVVAIGS 120 Query: 121 LLIPMMRDNGYPVPRSAGLIASGGIIAPIIPPSMPFIIFGVTTNTSISGLFMAGIVPGLL 180 +++P M G+P AG+I + G + +IPPS+ +++ V TNTS+ LFMAG++PGL+ Sbjct: 121 IILPAMVKQGFPNKFGAGVITTSGALGILIPPSLVMVMYAVATNTSVGALFMAGVIPGLV 180 Query: 181 MGAGL-VITWMFVVRGMTVKLQPKASWGERRTALVEGVWALALPVIIIGGLRGGIFTPTE 239 + L +TW + +L P A+W +R A E +W LAL VI+IGG+ G+FTPTE Sbjct: 181 LATVLGAVTWYIAWKNDYPRL-PPATWAQRFRAFREAIWGLALIVIVIGGIYTGVFTPTE 239 Query: 240 AAVVAAVYSLVVALFVYRQVTLKDLVPLLVQAARTTSTVMFLCAAALVSSYMVTLADLPQ 299 AA ++AVY+ ++A+FVY+ + LK + +L+ +A ++ ++++ A++ S+++ ++P Sbjct: 240 AAAMSAVYAFLIAVFVYKDMPLKGVGKILLSSASMSAMLLYIITNAVLFSFVLANENIPH 299 Query: 300 QMNEMLAPLLHEPKLLMVAITLLLLAVGTVMDLTPTILVLGPVLTPLAAAAGIDPTYFGV 359 + + + ++ + +LLL G M+ + +L++ P+L P+A GIDP +FG+ Sbjct: 300 AIADWIVGKELGVIAFLLVVNVLLLVAGNFMEPSSIVLIMAPILFPVAMKLGIDPIHFGI 359 Query: 360 MFVLTGTLGLIHPPVCTVLNVVCGVARISLESATRGIWPFLLTYLLLLCLLIAVPEI 416 + V+ +G+ HPPV L V G+ ++ + T +WP+LL L L ++ P + Sbjct: 360 LIVVNMEVGMCHPPVGLNLYVASGITKMGITELTVAVWPWLLAMLGFLMVVTYWPPL 416 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 427 Length adjustment: 32 Effective length of query: 394 Effective length of database: 395 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory