Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_011385763.1 AMB_RS17210 molybdenum import ATP-binding protein ModC
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_000009985.1:WP_011385763.1 Length = 363 Score = 144 bits (362), Expect = 5e-39 Identities = 80/212 (37%), Positives = 132/212 (62%), Gaps = 13/212 (6%) Query: 8 NIRKRYGEVETLKGIDIALESGEFLVLL-GSSGCGKSTLLNIIAGLAEPSGGDI------ 60 ++R+R GE +D+ L +G + L G SG GK++++N++AGL+ P G I Sbjct: 5 DLRRRQGEFR----LDVRLSAGPGVTALYGRSGSGKTSVINMVAGLSRPDEGSISVDGRV 60 Query: 61 LIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARL 120 L RS + + P+ R + VFQ + L+P+LSV N+ FG ++ +P AE +++ L Sbjct: 61 LFDSRSGIDLPPEARRLGYVFQEHRLFPHLSVRGNLEFGQKL--LPSAERTQSLDKVVEL 118 Query: 121 LQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLH 180 L IE+LLDR+P++LSGG++QRVAIGRAL+ +P++ L DEPL+ LD + E+ + +L Sbjct: 119 LGIESLLDRRPAKLSGGEKQRVAIGRALLASPRILLMDEPLAALDPARKAEVLPFIAQLA 178 Query: 181 QMLRTTVVYVTHDQIEAMTLATRIAVMRDGRI 212 + ++YV+H E + LA +A+M G++ Sbjct: 179 RRFSVPILYVSHSMDEVLRLADTLALMDGGKV 210 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 363 Length adjustment: 29 Effective length of query: 331 Effective length of database: 334 Effective search space: 110554 Effective search space used: 110554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory