Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_011382978.1 AMB_RS02755 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_000009985.1:WP_011382978.1 Length = 553 Score = 162 bits (409), Expect = 2e-44 Identities = 97/212 (45%), Positives = 132/212 (62%), Gaps = 5/212 (2%) Query: 1 MTALQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEI 60 M L+L V KS+G VL+DI+L +EDGEF+ +G SG GK+TL+ +++GL AGE+ Sbjct: 1 MPILELKGVAKSYGASSVLRDIDLEIEDGEFIAILGFSGSGKTTLVSLMAGLIKPDAGEV 60 Query: 61 SIGGQTVTTTPPAKRGIAMVFQSYALYPHLSVRENMALALK--QERQPKEEIAARVAEAS 118 + G+ V P A RG+ VFQSY+L P L+V N+ALA+ K E ARVA+ Sbjct: 61 LLRGKPVDG-PGADRGV--VFQSYSLMPWLTVEGNIALAVDAVMPDASKAERKARVAKYI 117 Query: 119 RMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIAR 178 M+ L +RRPSELSGG RQRVA+ RA+ P + L DEPLS LDA R + EI Sbjct: 118 GMVGLSHAAERRPSELSGGMRQRVAVARALAMSPDILLLDEPLSALDALTRAKLQDEIEA 177 Query: 179 LHRQLSASMIYVTHDQIEAMTLADKIVVLRDG 210 + Q ++I +T+D EA+ LAD+I+ L G Sbjct: 178 IWEQEKKTVILITNDVDEALLLADRIIPLNPG 209 Score = 127 bits (320), Expect = 5e-34 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 7/206 (3%) Query: 14 GPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEISIGGQTVTTTPPA 73 GP+ V+ +L + GEF+ +G SGCGKST+L + +GL D + G + + G+ V+ P Sbjct: 307 GPLTVVDGFDLKMHQGEFISLIGHSGCGKSTVLTMTAGLTDVSEGGVILDGREVSEAGPD 366 Query: 74 KRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRMLS---LEDYLDRR 130 + A+VFQ+ +L+P L+ +N+AL + + P A R+ S L L D +D++ Sbjct: 367 R---AVVFQAPSLFPWLTALQNVALGVDRV-YPHASPAERLDIVSYYLERVGLGDSMDKK 422 Query: 131 PSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARLHRQLSASMIYV 190 S++S G RQRV I RA PKL L DEP LD+ R + + + + + I V Sbjct: 423 ASDMSNGMRQRVGIARAFALSPKLLLLDEPFGMLDSLTRWELQEVLMEVWTRTRVTAICV 482 Query: 191 THDQIEAMTLADKIVVLRDGRIEQVG 216 THD EA+ LADK+V++ +G ++G Sbjct: 483 THDVDEAILLADKVVMMTNGPNARIG 508 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 331 Length of database: 553 Length adjustment: 32 Effective length of query: 299 Effective length of database: 521 Effective search space: 155779 Effective search space used: 155779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory