Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_011384511.1 AMB_RS10655 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_000009985.1:WP_011384511.1 Length = 321 Score = 259 bits (663), Expect = 5e-74 Identities = 146/311 (46%), Positives = 183/311 (58%), Gaps = 4/311 (1%) Query: 1 MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHK--VEVKD 58 M++ LV D+GGT+AR AL GE DY I+ YL EH V K Sbjct: 1 MSQMVLVADIGGTHARFALMG-PDGEAVNPVVLRCADYDGPAPAIKAYLAEHAGGVAPKG 59 Query: 59 GCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQ 118 G A+A I GD + +TN W FSIAE ++ +G LE++NDFTAV++++ LK EHL+ Sbjct: 60 GAFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMS 119 Query: 119 FGGAEPVEGKPIAVYGAGTGLGVAHLV-HVDKRWVSLPGEGGHVDFAPNSEEEAIILEIL 177 GG P G PIAV G GTGLGV+ L+ W +L EGGHV A +E EA IL+ L Sbjct: 120 VGGGMPEAGLPIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDRL 179 Query: 178 RAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLF 237 R + HVSAERVLSG GLVNLY+A+ P IT+R L SC R A+ +F Sbjct: 180 RTQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEVF 239 Query: 238 CVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVY 297 +MG GNLAL+LG GGVFIAGGI+PR E F+ S FR FE GRF+ Y+ IP + Sbjct: 240 FAMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPTW 299 Query: 298 LIVHDNPGLLG 308 LI H P +G Sbjct: 300 LITHPLPAFVG 310 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 321 Length adjustment: 28 Effective length of query: 293 Effective length of database: 293 Effective search space: 85849 Effective search space used: 85849 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory