Align Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (characterized)
to candidate WP_011385113.1 AMB_RS13750 glucosamine-6-phosphate deaminase
Query= reanno::PV4:5208303 (268 letters) >NCBI__GCF_000009985.1:WP_011385113.1 Length = 261 Score = 216 bits (550), Expect = 4e-61 Identities = 128/265 (48%), Positives = 169/265 (63%), Gaps = 5/265 (1%) Query: 1 MQIVILKDSAEVAEYGANLIINQLKRKPDSVLGLATGSTPVSLYQRLVAANQAGAVSFEG 60 M+++I + VAE A+L+ KPD V+GLA G+TP+++Y RL + A ++ F Sbjct: 1 MRVLIEPNGPSVAERAASLVGALALSKPDCVIGLAAGATPLAMYARLT--DPARSLDFSR 58 Query: 61 VTSFNLDEYLGLEGSHPQSYRYFMDSQLFDAIDINKANTHVPPGDA-EDPIAACEAYEAQ 119 T F LDEYLGL HP S + D I + H+ G A ED A C AYE + Sbjct: 59 ATIFGLDEYLGLGEEHPASCALTLRQHFIDKAGIPPSRVHLLDGRAAEDLPAYCAAYEER 118 Query: 120 IQAAGGIDIQLLGIGRNGHIGFNEPSSGLMSRTRVKTLTQATIEDNARFFAEGEYQPHLS 179 I AAGG+D+Q+LG+G NGHIGFNEP SGL RTR+ L ++T NA FA E P + Sbjct: 119 IAAAGGLDLQILGLGVNGHIGFNEPGSGLACRTRLVGLRRSTRRTNAPIFAPAEV-PKAA 177 Query: 180 ITMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRDAVLVIDEAAAS 239 +T GIGTIL A+++LLLATG +KA+A+ +EG +SA PASALQLH DAV+++DEAAA+ Sbjct: 178 LTTGIGTILAARRILLLATGPAKAEAVAKMIEGPVSAVIPASALQLHPDAVVILDEAAAA 237 Query: 240 KLADKEFYRHIEAENQLLQARLAAL 264 LA E YR EAE L + +AAL Sbjct: 238 GLALAEDYRD-EAEILLQRGGIAAL 261 Lambda K H 0.316 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 261 Length adjustment: 25 Effective length of query: 243 Effective length of database: 236 Effective search space: 57348 Effective search space used: 57348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory