GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Magnetospirillum magneticum AMB-1

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate WP_011386738.1 AMB_RS22220 phosphoenolpyruvate--protein phosphotransferase

Query= reanno::BFirm:BPHYT_RS02740
         (854 letters)



>lcl|NCBI__GCF_000009985.1:WP_011386738.1 AMB_RS22220
           phosphoenolpyruvate--protein phosphotransferase
          Length = 596

 Score =  325 bits (832), Expect = 6e-93
 Identities = 209/560 (37%), Positives = 302/560 (53%), Gaps = 15/560 (2%)

Query: 278 QAVARPAGETLAPNTLAGVCAAPGVAVGKLVRWDDADIDPPEKANGTSA--AESRLLDKA 335
           +AV R      A     G+  + G+A+G L   D   I  PE     +   AE    ++A
Sbjct: 8   KAVGRSKATARAELVRDGLGVSRGIAIGTLYLHDAGTITVPELRIPAARLDAECARFNEA 67

Query: 336 IATVDADLDTTVRDASQR--GAVGE--AGIFSVHRVLLEDPTLLDAARDLISLGK-SAGF 390
            A     ++  ++D + R  GA GE    +   +R +L    LL      I   + +A  
Sbjct: 68  SANAGRQVEQ-LQDKAGRLGGAAGEELGYLLDAYRQMLHGSRLLRGVEARIRNDRINAEA 126

Query: 391 AWREAIRAQIAILTNIEDALLAERAADLRDIEKRVLRALGYTSATART-LPEEAVLAAEE 449
           A ++ I   +     +ED  LA R AD++DI +R+LRAL  T+    T LP  AV+ AEE
Sbjct: 127 AVQQEINEIVRGFEAMEDPYLAARVADIKDIGRRLLRALTNTAYRPFTALPRNAVIVAEE 186

Query: 450 FTPSDLSTLDRSRVTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVVVNA 509
            TP+D + LD ++V  L    GG+  H AI+AR  G+P+++ + D L  +  G QV+++ 
Sbjct: 187 MTPADTALLDPNQVAGLATVMGGSEGHTAIMARSLGLPSVLGIADLLTGVKGGEQVIIDG 246

Query: 510 TTGRLEFAPTELDVERARLERTRLADVREANRRTSQQAAVTSDGRAIEVAANIATLDDAK 569
           T G +   P    +   R ER      R    R     AVT DG  I + AN+   ++  
Sbjct: 247 TNGLVVINPGPETLAFYRRERAAFLKARRVLSRLKDVPAVTRDGGRITLQANMELPNEVG 306

Query: 570 TAVENGADSVGLLRTELLFIHRAAAPTTDEHRQSYQAIVDALSGRTAIIRTLDVGADKEV 629
             +++GA+ +GLLR+E L+++R   P+ DE     + +V+ + GRT  +RT D G DK  
Sbjct: 307 AVLDSGAEGIGLLRSEFLYMNRDDVPSEDEQYAILKDVVERMGGRTVTVRTFDAGGDKLA 366

Query: 630 DYLTLPPEPNPALGLRGIRLAQVRPDLLDDQLRGLLAVQPLGAVRILLPMVTDVGELIRI 689
             L     PNP+LGLR IRL   R DLL+ QL  +L     G VRIL+PM+  VGEL   
Sbjct: 367 PALGCTIGPNPSLGLRAIRLGLARQDLLEAQLAAILRASAHGPVRILIPMIATVGELRAT 426

Query: 690 RKRIDEFARELGRT-----EPI-EVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTL 743
           R+ ++   R L +      +P+  +G MIE+P AAL AD +A HADF +IGTNDL QYTL
Sbjct: 427 REVMNRVIRRLRKAGVSLPDPLPRLGAMIEIPGAALSADSIAWHADFFAIGTNDLVQYTL 486

Query: 744 AMDRCQADLAAQADGLHPAVLRLIAATVQGADKHGKWVGVCGALAGDPLAMPLLVGLGVT 803
           A+DR    +A   + LHPAVLRLI  T Q A +    V VCG +AGDP   PLL+GLG+ 
Sbjct: 487 AIDRSDEAVAHLYNPLHPAVLRLIQFTTQAAQRANIPVSVCGEMAGDPRYAPLLLGLGLR 546

Query: 804 ELSVDPVSVPGIKARVRNLD 823
           +LS+   ++P +K R+R+LD
Sbjct: 547 DLSMSTSNLPVVKNRIRSLD 566


Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1067
Number of extensions: 40
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 854
Length of database: 596
Length adjustment: 39
Effective length of query: 815
Effective length of database: 557
Effective search space:   453955
Effective search space used:   453955
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory