Align N-acetyl-D-glucosamine kinase; EC 2.7.1.59; GlcNAc kinase (uncharacterized)
to candidate WP_043744689.1 AMB_RS14985 transcriptional regulator
Query= curated2:Q9KRV2 (302 letters) >NCBI__GCF_000009985.1:WP_043744689.1 Length = 297 Score = 193 bits (490), Expect = 5e-54 Identities = 122/296 (41%), Positives = 158/296 (53%), Gaps = 11/296 (3%) Query: 4 GFDVGGTKIEFGAFNEQLERVATERVATPTDDYAKLVETIAGLVHKYDAQFGVEGTVGLG 63 G D+GGTK E A + +A +RVAT Y + TI GLV +++ G +VG+G Sbjct: 6 GIDLGGTKTEAIALDLSGRELARQRVATARGSYDGTIATIKGLVEGLESRLGAAASVGIG 65 Query: 64 IPGMEDADNGCVLTVNVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELKEAA 123 IPG G + N GKPL DLET LGR V++ NDA+CFALSEA D Sbjct: 66 IPGTISPRTGLIKNANSTWLIGKPLDRDLETALGRPVRLANDADCFALSEATDGAGAGFD 125 Query: 124 SVMGLILGTGFGGGLVYEGKVFSGRNHVAGEIGHMRLPIDAWFHLGEKAPLLGCGCGNKG 183 +V G+ILGTG GGG+V G++ SG N +AGE GH LP W E+ P C CG G Sbjct: 126 TVFGVILGTGVGGGIVAHGRLLSGPNAIAGEWGHNPLP---WPEDAER-PGPACYCGRSG 181 Query: 184 CMDNYLSGRGFELLYEHYYGEKKKAIDIITAQKEGESKAVEHVERFMELLAICFANIFTA 243 C++ +LSG G L +H G A + T+ A+ ER LA A + Sbjct: 182 CIETFLSGPG--LARDH--GGGLSAEQLATSDDAAAGAALARYER---RLARALAAVINV 234 Query: 244 NDPHVVVLGGGLSNYDLIYEEMPKRVPKHLLSVAKCPKIVKAKHGDSGGVRGAAFL 299 DPHV+VLGGGLS D +Y +P + S + +HGDS GVRGAA+L Sbjct: 235 IDPHVIVLGGGLSKLDRLYRNVPALWEGFVFSDHVDTLLRPPRHGDSSGVRGAAWL 290 Lambda K H 0.319 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 297 Length adjustment: 27 Effective length of query: 275 Effective length of database: 270 Effective search space: 74250 Effective search space used: 74250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory