Align D-glycerate 2-kinase (EC 2.7.1.-) (characterized)
to candidate WP_011385540.1 AMB_RS16015 glycerate kinase
Query= reanno::psRCH2:GFF1145 (423 letters) >NCBI__GCF_000009985.1:WP_011385540.1 Length = 426 Score = 470 bits (1210), Expect = e-137 Identities = 246/419 (58%), Positives = 305/419 (72%), Gaps = 1/419 (0%) Query: 1 MTLDPQALLRQLFDSAIEAAHPRHVLADHLPEDRSGRAIVIGAGKAAAAMAEAIEKVWEG 60 MT + LLR++FD+A+ AA P + +LP GR IVIGAGKA+AAMA A+E W G Sbjct: 1 MTQSHRDLLRRMFDAAVAAAQPAQCVPAYLPAVPKGRLIVIGAGKASAAMARAVEDNWAG 60 Query: 61 ELSGLVVTRYEHHADCKRIEVVEAAHPVPDDAGERVARRVLELVSNLEESDRVIFLLSGG 120 E+SGLVVTRY ++ C+RI + EAAHPVPD AG AR++L+LVS+L D V+ L+SGG Sbjct: 61 EVSGLVVTRYGYNVPCRRITIAEAAHPVPDAAGLNAARKMLDLVSDLTADDLVLCLISGG 120 Query: 121 GSSLLALPAEGISLADKQAINKALLRSGAHIGEMNCVRKHLSAIKGGRLAKACWPASVYT 180 GS+L LP +G++L DKQ +N+ALL+SGA I EMNCVR+HLSAIKGGRLA AC PA V T Sbjct: 121 GSALAPLPLDGLTLEDKQDVNRALLKSGATISEMNCVRRHLSAIKGGRLAAACHPARVVT 180 Query: 181 YAISDVPGDEATVIASGPTVADPTTSEQALEILERYHIEVPANVRAWLEDPRSETLKPGD 240 ISDVPGD IASGPTVADPTT A+ I+ RY I V V LE R E++KPGD Sbjct: 181 LLISDVPGDNPMNIASGPTVADPTTCTDAMAIIRRYGIVVSDKVLDVLESGRGESVKPGD 240 Query: 241 PMLSRSHFRLIATPQQSLDAAAEVARAAGITPLILGD-LEGEAREVAKVHAGIARQVVLH 299 P L+ + +IA PQ +L+AAA+VA +AG T ILGD +EGEA++V V AGIA QV Sbjct: 241 PRLALTETHVIAAPQVALEAAAKVAESAGFTAHILGDSIEGEAKDVGAVMAGIAHQVTKR 300 Query: 300 GQPIAAPCVILSGGETTVTVRGNGRGGRNAEFLLALTENLQGLPNVYALAGDTDGIDGSE 359 GQP PCV+LSGGE TVTVRG GRGG N EFLLAL L G P ++A+AGDTDG+DG E Sbjct: 301 GQPFKPPCVLLSGGEATVTVRGQGRGGPNVEFLLALAVALNGQPGIHAIAGDTDGVDGME 360 Query: 360 DNAGALMMPDSYARAETLGLRAADALANNDGYGYFAALDDLIVTGPTRTNVNDFRAILI 418 D AGA++ P++ +RA +G++ D+LA ND + +F AL D +VTGPT TNVNDFRAILI Sbjct: 361 DIAGAIITPNTLSRAWVMGIKPQDSLAANDAHRFFHALGDSVVTGPTLTNVNDFRAILI 419 Lambda K H 0.316 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 490 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 426 Length adjustment: 32 Effective length of query: 391 Effective length of database: 394 Effective search space: 154054 Effective search space used: 154054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory