Align D-glycerate 2-kinase (EC 2.7.1.-) (characterized)
to candidate WP_050750703.1 AMB_RS11570 glycerate kinase
Query= reanno::psRCH2:GFF1145 (423 letters) >NCBI__GCF_000009985.1:WP_050750703.1 Length = 405 Score = 454 bits (1169), Expect = e-132 Identities = 245/408 (60%), Positives = 294/408 (72%), Gaps = 5/408 (1%) Query: 12 LFDSAIEAAHPRHVLADHLPEDRSGRAIVIGAGKAAAAMAEAIEKVWEGELSGLVVTRYE 71 +F++A+EAA P L LP GR +VIGAGKAAAAMA A+E W+G LSGLVVTRY Sbjct: 1 MFEAAVEAAKPSACLPPALPAPPPGRTLVIGAGKAAAAMARAVEDHWQGPLSGLVVTRYG 60 Query: 72 HHADCKRIEVVEAAHPVPDDAGERVARRVLELVSNLEESDRVIFLLSGGGSSLLALPAEG 131 H +RIEVVEAAHPVPD AGE A R+++L++ + D V+ L+SGGGS+LLA PAEG Sbjct: 61 HCVPTRRIEVVEAAHPVPDAAGEHAAGRMMDLLAGVGADDLVLCLISGGGSALLARPAEG 120 Query: 132 ISLADKQAINKALLRSGAHIGEMNCVRKHLSAIKGGRLAKACWPASVYTYAISDVPGDEA 191 I+LA+KQA+ ALLRSGA IGE+NCVRKHLSA+KGGRLA PA + T AISDVPGD Sbjct: 121 ITLAEKQALTGALLRSGAAIGEINCVRKHLSAVKGGRLAALAAPARLVTLAISDVPGDNP 180 Query: 192 TVIASGPTVADPTTSEQALEILERYHIEVPANVRAWLEDPRSETLKPGDPMLSRSHFRLI 251 +VIASGPTVADPTT +A +L RY I P + A L DP +ET K P +RLI Sbjct: 181 SVIASGPTVADPTTLAEARAVLARYGIAPPPAIAARLNDPAAETPKSLPP----GEYRLI 236 Query: 252 ATPQQSLDAAAEVARAAGITPLILGD-LEGEAREVAKVHAGIARQVVLHGQPIAAPCVIL 310 ATPQ+SL+AAA VA AG+ PL+LGD LEGEARE+A+V AGI + + H QP+ P VIL Sbjct: 237 ATPQRSLEAAALVAARAGLMPLLLGDALEGEAREMARVMAGIVKSIRAHQQPVPMPAVIL 296 Query: 311 SGGETTVTVRGNGRGGRNAEFLLALTENLQGLPNVYALAGDTDGIDGSEDNAGALMMPDS 370 SGGE TVT+RG G+GG NAEF LAL L+ V A+A DTDGIDGSEDNAGA++ PD+ Sbjct: 297 SGGEATVTIRGQGKGGPNAEFALALALALKDTQGVEAIACDTDGIDGSEDNAGAVITPDT 356 Query: 371 YARAETLGLRAADALANNDGYGYFAALDDLIVTGPTRTNVNDFRAILI 418 RA LGL L ND YG+F L DL+ GPT TNVNDFRA+L+ Sbjct: 357 AERARALGLNLESYLNQNDSYGFFNTLGDLVKCGPTLTNVNDFRAVLV 404 Lambda K H 0.316 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 405 Length adjustment: 31 Effective length of query: 392 Effective length of database: 374 Effective search space: 146608 Effective search space used: 146608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory