Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate WP_043744492.1 AMB_RS12805 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >NCBI__GCF_000009985.1:WP_043744492.1 Length = 290 Score = 116 bits (290), Expect = 7e-31 Identities = 85/279 (30%), Positives = 132/279 (47%), Gaps = 8/279 (2%) Query: 6 LFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIA 65 +F G I + T F +G++D+ L+ I G + G+ GE L +E + Sbjct: 1 MFKGSITALITPFR-NGKVDEKAFQDLVAWQIAEGTHAVVPCGTTGESPTLSHDEHHRVV 59 Query: 66 RFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFE 125 ++ +VPV+ GTG + E + L+QHA++AGAD +V+ PYY K S+ L R+FE Sbjct: 60 ELCLEVARGKVPVIAGTGSNSTDEAVALTQHARKAGADAALVVAPYYNKPSQEGLFRHFE 119 Query: 126 QVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKG 185 +A SV +P+++YN P + D++ L+ + NI GIK D+ A L + Sbjct: 120 AIAKSVDIPIIVYNIPGRSVIDISVETFVRLS-ALPNIAGIK---DATADLARPLRIRAA 175 Query: 186 AHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTL 245 L G D GG G IS + N AP++ + AW GD+A ++ L Sbjct: 176 LDERLCQLSGEDATAIAFNAQGGVGCISVTSNIAPKLCARMQNAWAAGDLATCNELNKIL 235 Query: 246 LQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLP--PAS 282 + + +T V K A L G+ LP PAS Sbjct: 236 MPLHDALFCETSPAPV-KYAASLLGKSAPDVRLPLVPAS 273 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 290 Length adjustment: 26 Effective length of query: 276 Effective length of database: 264 Effective search space: 72864 Effective search space used: 72864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory