Align Possible transporter of polar amino acids including glutamate, glutamine and aspartate, DmeA. It complements a sepJ mutation in Anabaena (TC# 2.A.7.23.2), and SepJ complements a dmeA mutation. Alternatively, and less likely, it could be an activator of an ABC transporter catalyzing uptake of these amino acids (characterized)
to candidate WP_011385186.1 AMB_RS14120 EamA family transporter
Query= TCDB::Q31PG5 (330 letters) >NCBI__GCF_000009985.1:WP_011385186.1 Length = 295 Score = 90.5 bits (223), Expect = 5e-23 Identities = 84/287 (29%), Positives = 124/287 (43%), Gaps = 18/287 (6%) Query: 24 LAIATALWGGTFTAGRIAVQQLSPLAVACGRYLLATT--VLLLILWQREGWPPLNRRQQL 81 LA+ +WGG + +I + + PL R L V++L+ R PP R Sbjct: 7 LALLVLIWGGNWPIMKIGLAHIQPLWFCAFRLALGVVSMVIILVPLGRLRLPP--RGDWP 64 Query: 82 LLFGLGVSGIALYNWLFFIGLSLIPASRAALIIALNPTAIALGAAIWTGDRLRSWQWAGV 141 +L LG+ +AL+ L + L ++PA R+A++ P +A GAA++ G++L + AGV Sbjct: 65 VLMSLGLLNMALFMVLSNLALLVVPAGRSAILAYTTPLWVAPGAALFLGEKLTGGRMAGV 124 Query: 142 GLSLIGAILLL-------GSRQAGALTLPGWGDLALVGCVLCWTVYSLLARQALRSLSPL 194 L L G ++L G+ A G+L L+ L W L R SPL Sbjct: 125 LLGLGGIVVLFNPLSFDWGNHDAVV------GNLMLLAAALVWAAAILHVRGHRWCSSPL 178 Query: 195 TVTTGACCWGSVLLIGLWLGQGAQLPVNVSFSTGSAIAFLGLGGTALAFCLYANGIERLG 254 + G V + L +GA P + SF + + G TA AF L Sbjct: 179 DLAPWQMVIGLVPVAAAALIEGAPRP-DGSFELAWTLIYNGTLATAFAFWAAVTVNRLLP 237 Query: 255 AARAGLFINLVPVFGSAIGALLLQEPLSGLTLLGGLLVLAGVGLGTL 301 A L VP G AL+L E LS + G L+ GVG+ L Sbjct: 238 ALTVSLSFLCVPAGGLVFSALMLGEGLSLTNVAGLALIAGGVGIVAL 284 Lambda K H 0.325 0.142 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 295 Length adjustment: 27 Effective length of query: 303 Effective length of database: 268 Effective search space: 81204 Effective search space used: 81204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory