GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glmS in Magnetospirillum magneticum AMB-1

Align glutamate mutase α subunit (EC 5.4.99.1) (characterized)
to candidate WP_043743213.1 AMB_RS02225 methionine synthase

Query= metacyc::MONOMER-16253
         (151 letters)



>NCBI__GCF_000009985.1:WP_043743213.1
          Length = 1157

 Score = 55.8 bits (133), Expect = 2e-12
 Identities = 29/87 (33%), Positives = 50/87 (57%)

Query: 9   TVILGVIGSDAHVVGITILEQALSAAGFEVINLGVQTAQDEFVSAAKSHDAEAVLVSSLY 68
           T++L  +  D H +G  +++  L+  G++VIN+G++    E + AAK H A+AV +S L 
Sbjct: 717 TMVLATVKGDVHDIGKNLVDIILTNNGYKVINIGIKQPVAEIIKAAKEHKADAVGMSGLL 776

Query: 69  GHARQDCEGLHDELDDAGLDVLTYVGG 95
             +        +E+ +AGLDV   +GG
Sbjct: 777 VKSTVIMRENLEEMTNAGLDVPVLLGG 803


Lambda     K      H
   0.316    0.133    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 347
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 151
Length of database: 1157
Length adjustment: 31
Effective length of query: 120
Effective length of database: 1126
Effective search space:   135120
Effective search space used:   135120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory