Align (S)-citramalyl-CoA lyase (EC 4.1.3.25); (R)-citramalyl-CoA lyase (EC 4.1.3.46) (characterized)
to candidate WP_011386303.1 AMB_RS19980 CoA ester lyase
Query= BRENDA::A0A172MLA1 (322 letters) >NCBI__GCF_000009985.1:WP_011386303.1 Length = 292 Score = 141 bits (355), Expect = 2e-38 Identities = 96/305 (31%), Positives = 152/305 (49%), Gaps = 23/305 (7%) Query: 1 MASRNTLRRALLYIPGSSQRFIDKSRTLTADCVAYDLEDSVTPHKKAEARSLVRRALDQP 60 MA+ RR++LY+PGS+ R ++K+RTL AD + DLED+V P K ARS V A+ + Sbjct: 1 MATTARPRRSVLYMPGSNPRTLEKARTLPADGLILDLEDAVAPDAKDVARSQVVDAV-KA 59 Query: 61 APAGILERAVRINSVDSGLALADLTEVLQSPNLSTIVIPKVNSASDLTFVTDVITHTLSQ 120 G E +R+NS+ + AD+ S ++IPKV SA T+ Q Sbjct: 60 GGYGARELLIRVNSLATPWGQADVAAAASS-GTHAVLIPKVESAD-----------TVRQ 107 Query: 121 LPLSQSASRPP--ISLLALVESAKSLTNLSQICAASPLLQGLIFAAEDFALDLSLTRTPA 178 + A+ P +++ ++E+ + + +I +SP + G + D A DL T Sbjct: 108 VEAIMVANGAPADMAIWCMMETPRGMLKAEEIAGSSPRMGGFVMGTSDLAKDLHCAHTRD 167 Query: 179 LTEFLFARSAIATAARAANLPSTIDLVCTTYKSDKGDGSPPVVLQQECRDGKNLGFNGKQ 238 + + AARA L + +D V D+G C+ G LGF+GK Sbjct: 168 RLPMITSLGLCLLAARAYGL-AALDGVYLDLNDDEG-------FAYSCQQGLELGFDGKT 219 Query: 239 CIHPSQVSTVQQIFGPELEEVQWAVRVTIADDKASKAGRGAWTLDGKMIDIPVAEKARAI 298 IHP + T ++F P +E++W+ ++ A +AS AG+G +DGK+I+ E AR I Sbjct: 220 LIHPKTIETANRVFAPAEKEIEWSKKIIAAHAEASAAGKGVVVVDGKLIENLHVENARRI 279 Query: 299 VKKAD 303 V +D Sbjct: 280 VALSD 284 Lambda K H 0.316 0.130 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 292 Length adjustment: 27 Effective length of query: 295 Effective length of database: 265 Effective search space: 78175 Effective search space used: 78175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory