Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_011384263.1 AMB_RS09395 ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_000009985.1:WP_011384263.1 Length = 273 Score = 124 bits (310), Expect = 4e-33 Identities = 75/212 (35%), Positives = 117/212 (55%), Gaps = 10/212 (4%) Query: 3 RITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPS 62 RI + + ++GA+ + D+SL E G LLGPSGCGK+T LN ++G L+P+ Sbjct: 16 RIGIQRLSVSFGAHAAVE-DFSL-----EIEPGEFVCLLGPSGCGKSTALNAVAGFLRPA 69 Query: 63 HGRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRD 122 GR+ DG +VT + VFQ ++ TV +N+AF R +G A+ R+ Sbjct: 70 RGRVAVDGVEVTGPGPER---GMVFQQHSLFPWKTVLENVAFGPRMQGKTRAEARDLARE 126 Query: 123 ILEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQ 182 L+++ L A+R L+ Q++ + R LV N + +L DEP +D + +++ Sbjct: 127 YLDLVGLGGSAQRYPAALSGGMAQRVGIARALV-NHPSVLLMDEPFGALDAQTRSIMQES 185 Query: 183 LKRLHKQFGFTMVYVTHDQTEALTFAEKVVVM 214 L RL Q G T+++VTHD EAL A++VVVM Sbjct: 186 LLRLWGQIGNTVLFVTHDIDEALFLADRVVVM 217 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 273 Length adjustment: 27 Effective length of query: 329 Effective length of database: 246 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory