Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate WP_011384260.1 AMB_RS09380 ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >NCBI__GCF_000009985.1:WP_011384260.1 Length = 256 Score = 140 bits (354), Expect = 2e-38 Identities = 87/244 (35%), Positives = 130/244 (53%), Gaps = 7/244 (2%) Query: 5 ARWMLGLAFFVVFVAVWAFFTLGGFVSPTFLASPITMAKEGWLLFTEYGFIKDIGMTIWR 64 AR+ L+ + VA WA G +P L SP +A + F +D+G ++ R Sbjct: 10 ARFSSALSGLGLLVAFWAL-AAAGLDNPVLLPSPAEVAGVLGEVIGSGAFHRDLGASLRR 68 Query: 65 VVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGEAQKI 124 V+GG+VLA+ +AVPL + M A+ + P +S R +P A+IPL ILW G+G+A Sbjct: 69 VLGGYVLASGLAVPLALVMAAWGPLRQSLLPVVSLLRPIPPIAWIPLAILWFGLGDAPSF 128 Query: 125 LVIFIGSVFQITLMV---AVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAETL 181 + I + F I L + VGG D AA LGA ++ V +P A P IA L Sbjct: 129 FITAIAAFFPIFLNAFAGGLAVGGRYLD---AARCLGATRLALLLEVRLPAALPMIATGL 185 Query: 182 RLVLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKAL 241 R+ LG +W V+ AELI + SG+G+MI ++ L T ++ G++ IG +G + +AF Sbjct: 186 RIGLGQSWMAVVTAELIAAQSGLGYMIQANRLTLQTAHVLVGMVTIGTLGALMTWAFTLA 245 Query: 242 NHRL 245 RL Sbjct: 246 ERRL 249 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 256 Length adjustment: 24 Effective length of query: 228 Effective length of database: 232 Effective search space: 52896 Effective search space used: 52896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory