Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate WP_011384264.1 AMB_RS09400 ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >NCBI__GCF_000009985.1:WP_011384264.1 Length = 294 Score = 142 bits (357), Expect = 1e-38 Identities = 79/246 (32%), Positives = 128/246 (52%), Gaps = 3/246 (1%) Query: 7 WMLGLAFFVVFVAVWAFFTLGGF---VSPTFLASPITMAKEGWLLFTEYGFIKDIGMTIW 63 W LG+ +F+A W TL V + SP + + + F + F++ I M++ Sbjct: 37 WALGITSLGLFLAAWHLATLYRLDLHVRFGNVPSPEAVLRRALVAFADPRFLEHIAMSVQ 96 Query: 64 RVVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGEAQK 123 R+ GF LAA++AVPLGIAMG + + + P + R +PA A++P+ I+ E Sbjct: 97 RIGAGFALAAIVAVPLGIAMGRFAPLRSAVYPVVEVLRPIPAIAWVPMSIMLWPSNEESI 156 Query: 124 ILVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAETLRL 183 + + F+GS F I + V LV A+ +LGAG + V +PGA P I L + Sbjct: 157 VFITFLGSFFPILINTLHGVAAIDPALVRASRSLGAGEAALFRHVFLPGALPHIFTGLTV 216 Query: 184 VLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKALNH 243 +G AW +I AE+I GIG+ ++ +L+ I+ G+++IG++GL S + L Sbjct: 217 GMGVAWVSLIAAEMISGQFGIGYFTWEAYALVQYADIVLGMLLIGVLGLASSGLIRLLGR 276 Query: 244 RLFAWS 249 + WS Sbjct: 277 AVMPWS 282 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 294 Length adjustment: 25 Effective length of query: 227 Effective length of database: 269 Effective search space: 61063 Effective search space used: 61063 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory