Align ABC transporter related (characterized, see rationale)
to candidate WP_011384493.1 AMB_RS10565 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000009985.1:WP_011384493.1 Length = 257 Score = 152 bits (385), Expect = 5e-42 Identities = 86/232 (37%), Positives = 143/232 (61%), Gaps = 14/232 (6%) Query: 4 TAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDG 63 T+ + + +HK+FG VL GI L +G+ + ++G SG+GKS L+C+ L P+ G Sbjct: 2 TSVPKIELTGVHKAFGPKVVLDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPESG 61 Query: 64 SVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRV 123 S+ + GE++ + P DR DR+ + GM+FQ L+ + V EN+ G ++ Sbjct: 62 SIRIDGEDVV-------GMGPKDR---DRIMKKFGMLFQGGALFDSLKVWENVAFGLIQG 111 Query: 124 QKRSRAESVEEAEALLAKVGLAEKRGHY-PAHLSGGQQQRVAIARALAMHPKVMLFDEPT 182 QK RA++ + A LA+VGLA G P+ LSGG Q+RV++ARA+A +P+++ FDEPT Sbjct: 112 QKMERAKARDIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPT 171 Query: 183 SALDPELVGEVLR--VMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQV 232 + LDP ++ +V+ +++ E G T L +TH+M AR +S+R+ L++G++ Sbjct: 172 TGLDP-IMADVINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRL 222 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory