Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate WP_011383782.1 AMB_RS06945 phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02121 (258 letters) >NCBI__GCF_000009985.1:WP_011383782.1 Length = 259 Score = 137 bits (344), Expect = 3e-37 Identities = 85/246 (34%), Positives = 134/246 (54%), Gaps = 12/246 (4%) Query: 19 IEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEE-----HQKG 73 I +N YG+ L DI+L + GE + GPSG GKST +RCINR+ + G Sbjct: 12 ISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCINRMNDMVDGAKVTG 71 Query: 74 KIVVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAP-IWVRKMPKKEAEQ 132 + +DG ++ + + ++R VGMVFQ N FP +I +N P I + E ++ Sbjct: 72 SLTLDGSDVYDRSLDVVQLRARVGMVFQKPNPFPK-SIYDNVAYGPRIHGLARDQAELDE 130 Query: 133 VAMHFLERVKI---PEQALKYPGQ-LSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEM 188 + M+ LE+ + E L G LSGGQQQR+ IAR++ + P+++L DEP SALDP Sbjct: 131 IVMNSLEKAGLLAEVESRLSESGTGLSGGQQQRLCIARAIAVAPEVILMDEPCSALDPIA 190 Query: 189 VKEVLDTMVGLAEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNPQHER 248 +V + ++ + T++ VTH M A +V+ R F G+++E E F NP+ Sbjct: 191 TAKV-EELIDELRDNYTIVIVTHSMQQAARVSQRTAFFHLGKLIEVGGTEEIFTNPKEPL 249 Query: 249 TKLFLS 254 T+ +++ Sbjct: 250 TQGYIT 255 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory