GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdB in Magnetospirillum magneticum AMB-1

Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_011384714.1 AMB_RS11710 pyruvate dehydrogenase complex E1 component subunit beta

Query= metacyc::MONOMER-11684
         (327 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384714.1 AMB_RS11710 pyruvate
           dehydrogenase complex E1 component subunit beta
          Length = 452

 Score =  246 bits (627), Expect = 1e-69
 Identities = 134/318 (42%), Positives = 192/318 (60%), Gaps = 3/318 (0%)

Query: 8   DAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAIAGVG 67
           +A+  AM EEM  D  VF++GE+V +  G +K + GL ++FG ERV+DTP+ E   AG+ 
Sbjct: 133 EALRDAMAEEMRADPNVFLMGEEVAQYQGAYKVSQGLLDEFGAERVIDTPITEMGFAGLA 192

Query: 68  IGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGAL 127
            GA   G++PI E    +F M A++ +I+ AAK  Y S     C IV R P G       
Sbjct: 193 CGAGYAGLKPIVEFMTMNFSMQAIDHVINSAAKTLYMSGGQQPCSIVFRGPNGAASRVGA 252

Query: 128 YHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVPAD 187
            HSQ   + +A+ PGLK++ P +  DAKGLLKAA+RD +PV+F E++  Y     +VP D
Sbjct: 253 QHSQDYASWYAHCPGLKVLAPWSAADAKGLLKAAIRDPNPVVFLENELLYGQ-SFDVPDD 311

Query: 188 -DYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEA 246
            D+VLPIGKA ++R G  +T+  Y   V  AL AAE L+ +GI A V++LR++ PLD   
Sbjct: 312 PDFVLPIGKAKIERAGAHVTITAYSRMVQVALDAAEILKAEGIEAEVINLRSIRPLDVAT 371

Query: 247 IIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTM 306
           I+ +  KT +++ V E      I SE+AA++ E     LDAP+ R+AG D+P MPYA  +
Sbjct: 372 IVASVQKTNRIVSVEEGWPVAGIGSEIAALMMEQAFDWLDAPVVRVAGADVP-MPYAANL 430

Query: 307 EKYFMVNPDKVEAAMREL 324
           EK  +   + V AA R +
Sbjct: 431 EKLALPQIEHVVAAARSV 448


Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 384
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 327
Length of database: 452
Length adjustment: 30
Effective length of query: 297
Effective length of database: 422
Effective search space:   125334
Effective search space used:   125334
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory