Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_011382625.1 AMB_RS00905 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= curated2:P24162 (257 letters) >NCBI__GCF_000009985.1:WP_011382625.1 Length = 261 Score = 224 bits (570), Expect = 2e-63 Identities = 120/249 (48%), Positives = 163/249 (65%), Gaps = 5/249 (2%) Query: 14 LAVITLDRPEVMNALNAAMRHELTAAL-HRARGEARAIVLTGSGRAFCSGQDLGDGAAEG 72 + ITL+RP +NA N M L +A+ H A R +V+TG+G+ FC+GQDL D ++ Sbjct: 13 VTTITLNRPGRINAFNVEMHGALRSAVAHAAEDGTRCLVITGAGKGFCAGQDLSDRVSKP 72 Query: 73 ----LNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVVIAAQSAAFM 128 +L L Y PL++++ + P+PV+AAVNG AAGAGANLALA D+V+AA+SAAF+ Sbjct: 73 GDPPPDLGASLDARYNPLIRSLKALPMPVIAAVNGTAAGAGANLALACDIVVAARSAAFV 132 Query: 129 QAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEAVPDVDFEHH 188 Q+F ++GL+PD+GGTW LPR VG ARA + + EK+ AE+A + G+IW V D Sbjct: 133 QSFCKVGLIPDSGGTWTLPRLVGTARATALMMLGEKVTAEQAMQWGMIWRCVDDEQLLPT 192 Query: 189 WRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADFREGVQAFLE 248 A AA LA P+ A +KKA +N L AQL LE LQ E G + D++EGV+AF+E Sbjct: 193 VLAMAAQLAAQPTRGLALMKKALARSGANTLDAQLDLERDLQTEAGCTQDYQEGVRAFME 252 Query: 249 KRPPHFTGR 257 KRPP F GR Sbjct: 253 KRPPRFEGR 261 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 261 Length adjustment: 24 Effective length of query: 233 Effective length of database: 237 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_011382625.1 AMB_RS00905 (2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase)
to HMM TIGR02280 (paaB: phenylacetate degradation probable enoyl-CoA hydratase PaaB (EC 4.2.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02280.hmm # target sequence database: /tmp/gapView.12727.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02280 [M=256] Accession: TIGR02280 Description: PaaB1: phenylacetate degradation probable enoyl-CoA hydratase PaaB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-120 384.9 2.4 1e-119 384.8 2.4 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011382625.1 AMB_RS00905 2-(1,2-epoxy-1,2-dih Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011382625.1 AMB_RS00905 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 384.8 2.4 1e-119 1e-119 1 256 [] 5 261 .] 5 261 .] 0.99 Alignments for each domain: == domain 1 score: 384.8 bits; conditional E-value: 1e-119 TIGR02280 1 illelekgvlrltlnrpdklnsfteemhaelaealerverddvrallltGaGrGfcaGqdlsernvtkg 69 il++ + v ++tlnrp ++n+f+ emh +l+ a+ ++ d+ r+l++tGaG+GfcaGqdls+r ++g lcl|NCBI__GCF_000009985.1:WP_011382625.1 5 ILVARTGDVTTITLNRPGRINAFNVEMHGALRSAVAHAAEDGTRCLVITGAGKGFCAGQDLSDRVSKPG 73 67788899************************************************************9 PP TIGR02280 70 .aapdlGetvekfynplvrrlaalpkpvvvavnGvaaGaGanlalagdivlaaesakfiqafaklGlip 137 ++pdlG +++ ynpl+r l+alp+pv++avnG aaGaGanlala+div+aa+sa f+q+f+k+Glip lcl|NCBI__GCF_000009985.1:WP_011382625.1 74 dPPPDLGASLDARYNPLIRSLKALPMPVIAAVNGTAAGAGANLALACDIVVAARSAAFVQSFCKVGLIP 142 899****************************************************************** PP TIGR02280 138 dsGGtwllprlvGrarakglallgekldaetaaewGliwqvvddealadevqalaahlakqptrglali 206 dsGGtw+lprlvG+ara++l +lgek+ ae+a++wG+iw++vdde+l +v a+aa+la+qptrglal+ lcl|NCBI__GCF_000009985.1:WP_011382625.1 143 DSGGTWTLPRLVGTARATALMMLGEKVTAEQAMQWGMIWRCVDDEQLLPTVLAMAAQLAAQPTRGLALM 211 ********************************************************************* PP TIGR02280 207 kralqaaetnsldtqldlerdlqrelGrsadyaeGvaafldkrepefkGk 256 k+al + +n+ld+qldlerdlq e+G ++dy+eGv af++kr p+f+G+ lcl|NCBI__GCF_000009985.1:WP_011382625.1 212 KKALARSGANTLDAQLDLERDLQTEAGCTQDYQEGVRAFMEKRPPRFEGR 261 ************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (261 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.26 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory