Align Probable enoyl-CoA hydratase echA12; EC 4.2.1.17 (uncharacterized)
to candidate WP_011384970.1 AMB_RS13030 enoyl-CoA hydratase
Query= curated2:Q7U004 (285 letters) >NCBI__GCF_000009985.1:WP_011384970.1 Length = 272 Score = 140 bits (354), Expect = 2e-38 Identities = 91/264 (34%), Positives = 138/264 (52%), Gaps = 25/264 (9%) Query: 28 EIAQITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSSGADHKSAGV 87 ++A +TLNRP+R N + FD L++ + Y + V+ V++TG+G F SG D Sbjct: 21 KVATLTLNRPDRKNPLTFDSYGELRDLFENMVYADDVKAVIVTGSGGNFCSGGD------ 74 Query: 88 VPHVENLTRPTYALRSMELLD------DVILMLRRLHQPVIAAVNGPAIGGGLCLALAAD 141 V + P + ELL+ D + +R QP+IAA++G G G L A+D Sbjct: 75 ---VHEIIGPLTKMDMPELLEFTRMTGDAVRAMRNAPQPIIAAIDGICAGAGTMLGCASD 131 Query: 142 IRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLV 201 IR+ ++ + + GL +++G LLPR IG SRA E++ TGR + EEAER+G Sbjct: 132 IRLGTARSKVAFLFVRVGLAGADMGACTLLPRLIGLSRAAELLYTGRAMGGEEAERVGYY 191 Query: 202 SRQVPDEQLLDACYAIAARMAGFSRPGIELTKRTLWS----GLDAASLEAHMQAEGLGQL 257 + E+LLDA +A +A G +TK+ LW GL +EA QA+ Sbjct: 192 NSLHAPEELLDAANKLAQSLANGPTFGHAMTKKMLWQEWNHGL-GECIEAEAQAQA---- 246 Query: 258 FVRLLTANFEEAVAARAEQRAPVF 281 + + T +FE A A A ++APVF Sbjct: 247 -ICMQTKDFERAYVAFANKQAPVF 269 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 272 Length adjustment: 25 Effective length of query: 260 Effective length of database: 247 Effective search space: 64220 Effective search space used: 64220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory