Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_011384978.1 AMB_RS13070 enoyl-CoA hydratase
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000009985.1:WP_011384978.1 Length = 256 Score = 231 bits (588), Expect = 1e-65 Identities = 120/251 (47%), Positives = 167/251 (66%) Query: 7 VDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAFAAGAD 66 ++ P V L+ + RP+A NALN ++ LA + D RA+V+TG+++AFAAGAD Sbjct: 6 LEKPFDSVVLLRINRPDAKNALNGEVRRLLAEHMTTLGADPSVRAIVMTGNQEAFAAGAD 65 Query: 67 IKEMAERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIAGEDAR 126 IK+MAE + +++ W+ IA KP+IAAVNG+ GGGCEL MHADI++AGE+A Sbjct: 66 IKDMAEVGAIELMQRNNHLLWRAIANCPKPVIAAVNGYAWGGGCELVMHADIIVAGENAS 125 Query: 127 FGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTLPELTI 186 F QPE+ +GIMPGAGGTQRL RAVGK AM MV++GQAI A + GL S V + Sbjct: 126 FSQPEVKVGIMPGAGGTQRLTRAVGKFKAMLMVMTGQAISGVEAGQMGLASVVVPDAEVV 185 Query: 187 ERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEGIRAF 246 ++AL IA+ I++ P+A+ KE LL +D L + L ER AF +L +AD+ EG++AF Sbjct: 186 DKALEIAKTISRMPPVAIAQIKEVLLAGQDASLDTALMLERKAFQLLFASADQKEGMKAF 245 Query: 247 QEKRRPEFTGR 257 EKR+P + G+ Sbjct: 246 IEKRKPTYQGK 256 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 256 Length adjustment: 24 Effective length of query: 233 Effective length of database: 232 Effective search space: 54056 Effective search space used: 54056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory