GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Magnetospirillum magneticum AMB-1

Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_011385133.1 AMB_RS13850 3-oxoadipyl-CoA thiolase

Query= metacyc::MONOMER-3207
         (400 letters)



>lcl|NCBI__GCF_000009985.1:WP_011385133.1 AMB_RS13850
           3-oxoadipyl-CoA thiolase
          Length = 400

 Score =  525 bits (1351), Expect = e-153
 Identities = 267/401 (66%), Positives = 320/401 (79%), Gaps = 2/401 (0%)

Query: 1   MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60
           M +  ICD  RTPIGR+ G+LAGVR DDLAA P+KAL+  +  + W +VDEV +GCANQA
Sbjct: 1   MTEALICDYTRTPIGRYAGSLAGVRTDDLAAHPIKALMARHAGLDWSRVDEVAYGCANQA 60

Query: 61  GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120
           GEDNRNVARMALLLAGLP SI G TLNRLC SGMDA+G A RA+ +GE EL IAGGVESM
Sbjct: 61  GEDNRNVARMALLLAGLPHSIGGTTLNRLCGSGMDAVGYAARAVMTGEAELMIAGGVESM 120

Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180
           SRAPFVM KA+S +SR+ +L DTTIGWRF+N LM+  YG DSMPETA+NVA+ + +SR D
Sbjct: 121 SRAPFVMNKADSAFSRDARLYDTTIGWRFVNALMEKAYGTDSMPETAENVAEQFNISRED 180

Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGE-TIVERDEHLRPETTLEALTKLKP 239
           QDAFA RSQ KA+AAQ  G FA+EI PV +  +KG+  +V  DEH R ETT+EAL KLK 
Sbjct: 181 QDAFAARSQAKASAAQKNGRFAQEISPVTLPARKGDPVVVSHDEHPR-ETTVEALAKLKA 239

Query: 240 VNGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPV 299
                 ++TAGNASGVNDGAAAL++AS  A K HGLTP AR+LGMA+ GV PR+MGIGPV
Sbjct: 240 PFRAGGSITAGNASGVNDGAAALLIASPAAAKAHGLTPIARILGMATAGVEPRIMGIGPV 299

Query: 300 PAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLG 359
           PA +KL  RLG+ ++D DV+E NEAFA+Q LA  R+LG+ADD  +VNPNGGAIALGHPLG
Sbjct: 300 PATQKLLARLGLTMADLDVMEFNEAFAAQALACTRQLGLADDDQRVNPNGGAIALGHPLG 359

Query: 360 MSGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400
           MSGAR+V TA  QL ++GGR+ L+TMC+GVGQG+A+AIERV
Sbjct: 360 MSGARIVGTAALQLAQTGGRRALSTMCIGVGQGIAMAIERV 400


Lambda     K      H
   0.318    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 501
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 400
Length adjustment: 31
Effective length of query: 369
Effective length of database: 369
Effective search space:   136161
Effective search space used:   136161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate WP_011385133.1 AMB_RS13850 (3-oxoadipyl-CoA thiolase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01930.hmm
# target sequence database:        /tmp/gapView.1946.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01930  [M=385]
Accession:   TIGR01930
Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   1.7e-139  451.0   7.9   1.9e-139  450.8   7.9    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011385133.1  AMB_RS13850 3-oxoadipyl-CoA thio


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011385133.1  AMB_RS13850 3-oxoadipyl-CoA thiolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  450.8   7.9  1.9e-139  1.9e-139       1     385 []       6     398 ..       6     398 .. 0.95

  Alignments for each domain:
  == domain 1  score: 450.8 bits;  conditional E-value: 1.9e-139
                                 TIGR01930   1 ivdavRtpigklggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaala 67 
                                               i d++Rtpig++ gsl+ ++ +dL+a+ ik+l++r  gld +++dev++G++ qage+  n+aR+a+l 
  lcl|NCBI__GCF_000009985.1:WP_011385133.1   6 ICDYTRTPIGRYAGSLAGVRTDDLAAHPIKALMARHaGLDWSRVDEVAYGCANQAGEDnRNVARMALLL 74 
                                               7899******99**********************************************9********** PP

                                 TIGR01930  68 aglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakl 136
                                               aglp+s+ ++t+nr+C+Sg++Av  aa+++++Gea++++aGGvEsmSr+p++++++   +s+  ++a+l
  lcl|NCBI__GCF_000009985.1:WP_011385133.1  75 AGLPHSIGGTTLNRLCGSGMDAVGYAARAVMTGEAELMIAGGVESMSRAPFVMNKA---DSAFSRDARL 140
                                               ***************************************************99997...4555556666 PP

                                 TIGR01930 137 edqllkdl........vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpve 197
                                               +d+++           ++   sm etAen+a++++isRe+qD++a+rS+ ka++A+++g+f++ei pv+
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 141 YDTTIGWRfvnalmekAYGTDSMPETAENVAEQFNISREDQDAFAARSQAKASAAQKNGRFAQEISPVT 209
                                               664433336778899888899************************************************ PP

                                 TIGR01930 198 vkgk...kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgl 263
                                               ++ +   ++vvs+De++r +tt+e+LakLk+ f+   gs +tAgN+s++nDGAaall++s ++ak++gl
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 210 LPARkgdPVVVSHDEHPR-ETTVEALAKLKAPFRA-GGS-ITAGNASGVNDGAAALLIASPAAAKAHGL 275
                                               *9999999**********.89************96.796.***************************** PP

                                 TIGR01930 264 tplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsld.lek 331
                                               tp+ari ++a+agv+p++mg+gpvpA++k+L++ gl++ d+d++E+nEAFAaq+la++++lg+ d +++
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 276 TPIARILGMATAGVEPRIMGIGPVPATQKLLARLGLTMADLDVMEFNEAFAAQALACTRQLGLADdDQR 344
                                               **************************************************************8667*** PP

                                 TIGR01930 332 vNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385
                                               vN nGGAiAlGHPlG+sGariv t + +L++ g++++l t+C+g GqG+A+ +e
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 345 VNPNGGAIALGHPLGMSGARIVGTAALQLAQTGGRRALSTMCIGVGQGIAMAIE 398
                                               ***************************************************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.39
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory